KEGG   Burkholderia vietnamiensis LMG 10929: AK36_2378Help
Entry
AK36_2378         CDS       T03893                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00020  Citrate cycle (TCA cycle)
bve00310  Lysine degradation
bve00380  Tryptophan metabolism
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
bve01120  Microbial metabolism in diverse environments
bve01130  Biosynthesis of antibiotics
bve01200  Carbon metabolism
Module
bve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bve00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK36_2378 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AK36_2378 (sucA)
   00380 Tryptophan metabolism
    AK36_2378 (sucA)
Enzymes [BR:bve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AK36_2378 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJY05596
LinkDB All DBs
Position
I:complement(2585859..2588723)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHYPIVESFAERAKANAFIPRESGSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPAFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKSGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLAIQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADGYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIIATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDPKKVKRVLACSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYEHATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSTSIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatatctcaacaatccggcgtcggtgccggaaaactgg
cgagagtatttcgacgcgctgcagaacgtgccggcaacggacggttcgaatgccaacgac
gtcgctcactacccgatcgtcgaatcgttcgccgagcgtgcgaaggccaatgccttcatc
ccgcgcgaaagcggcagcaatctggccaccgcgcgcaagcaggttcatgtccagtccctg
atcagcgcctatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccatccccgagctcgaacctgctttctacgacttctccgaaggcgacctc
gaccagacgtacagcgcaagcaacctgtacttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggcctgcgtgacacgtactgcggcacgatcggcgccgagtacatgtacatc
agcgatccggagcagaagcgctggtggcaggagcgcctcgaatcgacgcgcgcgacgccg
gcgttctcggccgacaagaagaagcacatcctgaatcgcctgacggccgccgaaggcctc
gagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagagcggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaacacgctgggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcattcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcg
gcgaaggcgcggatggaccgtcgcggcgacgacgacggcctgcaggtgctgccggtgcag
atccacggcgacgcggcattcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
caaacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtggtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgacgatcctgaagccgtcgtgctcgcg
atccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtg
tgcttccgcaagctgggtcacaacgaacaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctggttcag
cagggcgtgatcacggcggaagacgccgacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacaccgtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaaccgcaagtggacggacgcagccgatacggccgtgccgctc
gccgaactgaagcgcctgggcgaacgcatcaccacggtcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgtcgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgaacacctcgcattcgcgtcgctcgtcgcatcgggctatgcagtg
cgcctgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacgggtacgaaggccagggcccg
gaacactcgtcgacccgaatcgagcgtttcctgcaactgtgcgcggatcacaacatgcag
gtcgttcagccgaccaccccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcatcgctacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggatctgtccgagctcgcgaagggctcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacccgaagaaggtcaagcgtgtgctggcatgctcgggccgcgtgtactac
gacctcgtcgcgcaccgtcgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagcacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgcccggct
tcggcctcgccggcagttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcattcggccgcctgaagagcacatcgatcgcgaaataa

DBGET integrated database retrieval system