KEGG   Burkholderia vietnamiensis LMG 10929: AK36_3365Help
Entry
AK36_3365         CDS       T03893                                 

Definition
(GenBank) malic enzyme, NAD binding domain protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00620  Pyruvate metabolism
bve00710  Carbon fixation in photosynthetic organisms
bve01100  Metabolic pathways
bve01120  Microbial metabolism in diverse environments
bve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK36_3365
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AK36_3365
Enzymes [BR:bve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AK36_3365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AJY03690
LinkDB All DBs
Position
II:complement(369812..372112)
Genome map
AA seq 766 aa AA seqDB search
MKQTETQQQAAYDYHEFPTPGKISVVASKPLVTQRDLALAYTPGVASVCESIAAEPLNAH
RFTSRGNLVGVITNGTAVLGLGNIGALASKPVMEGKAVLFKKFAGIDVFDIEINETDPDK
LVDIIAGLEPTFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQHGTAITVAAAFINGL
KVVGKSISDVKVVTSGAGAAALACLDLLVDLGLPIENVWATDIEGVVYRGRTTLMDPAKE
RFAQETDARTLAEVIGGADIFLGLSAGGVLKPEMLSAMAARPLILALANPTPEIFPELAH
ATRDDVVIATGRSDFPNQVNNVLCFPYIFRGALDVGATTITREMEIAAVHAIAGLAQEEQ
SDIVAAAYGGDEVSFGPQYLIPKPFDPRLIVRIAPAVAKAAIEGGVATRPLADLDAYVEQ
LQQFVYHSGAFMKPLFAAARQLVRDGGKARIVFTEGEDERVLRAVQVIVDEKLARPILVG
RPEVLLARIERFGLRLRLGQDVEVTNPEYDERFPQYWTTYWELRCRDGISKEMARVEMRR
RLTLIGAMMVRLGDADGMICGTVGEYHNHLRFVDEVIGRKPDASTYAAMNILLLNQRTVA
LVDTHVNDNPDAEQIAEFTIAAARQMEWLNLTPKVALLSRSNFGSGSAASGAKMRNALEI
IRAQAPDIQADGEMHGDCALDESLRLRLLPMSPLKGAANLLVCPNVDAGNIAYNLLKTEA
GSNVAVGPFLLGVNAPVNILTSSATVRRIVNMTALTVIEANRNAAA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagacagagacccagcagcaagccgcgtacgactatcacgagtttccgacgccg
gggaagatctcggtcgtcgccagcaagccgctcgtgacgcagcgcgatctggcgctggct
tacacgccgggcgtcgcgagcgtctgcgagtcgatcgccgccgaaccgctgaacgcgcat
cgcttcacgagccgcggcaatctggtgggcgtgatcaccaacggcacggcggtgctgggt
ctgggcaacatcggcgcgctcgcgtcgaagccggtgatggaaggcaaggccgtgctgttc
aagaagttcgccgggatcgacgtgttcgacatcgagatcaacgagaccgacccggacaag
ctggtcgacatcatcgccggcctcgagccgaccttcggcgggatcaacctcgaggacatc
aaggcgcccgagtgcttcaccgtcgagcgcaagctgcgcgagcgcatgaagatccccgtg
ttccacgacgaccagcacggcaccgcgatcaccgtcgcggccgcgttcatcaacgggctg
aaggtggtcggcaagtcgatctcggacgtgaaggtcgtgacctcgggcgccggcgcggcc
gcgctcgcctgcctcgacctgctcgtcgacctcgggctgccgatcgaaaacgtgtgggcg
accgacatcgaaggcgtcgtctaccgcggccgcaccacgctgatggacccggccaaggag
cgcttcgcgcaggaaaccgacgcgcgcacgctggccgaggtgatcggcggcgccgacatc
ttcctcggcctgtcggccggcggcgtgctgaagccggagatgctgagcgcgatggccgcg
cgcccgctgatcctcgcgctcgcgaatccgacgccggagatcttcccggagctcgcgcat
gcgacccgcgacgacgtcgtgatcgcgaccggccgctcggatttcccgaaccaggtcaac
aacgtgctgtgcttcccgtacatcttccgcggcgcgctcgacgtgggcgcgaccacgatc
acgcgtgaaatggaaatcgccgcggtccacgcgatcgccggtctcgcgcaggaagaacag
agcgacatcgtcgcggcggcctatggcggcgacgaggtgtcgttcggcccgcaatacctg
attccgaagccgttcgacccgcgcctgatcgtccgtatcgcgccggcggtggcgaaggcc
gcgatcgaaggcggcgtcgcgacgcgcccgctcgccgacctcgacgcgtacgtcgagcag
ctgcagcagttcgtctatcactcgggcgcgttcatgaagccgctgttcgcggccgcgcgc
cagctggtgcgcgacggcggcaaggcgcgcatcgtgttcaccgagggcgaggacgaacgc
gtgctgcgcgcggtgcaggtgatcgtcgacgagaagctcgcgcgtccgatcctggtcggt
cgccccgaggtgctgctcgcgcgcatcgagcgcttcgggctgcgcctgcggctcggccag
gacgtcgaggtcaccaatccggaatacgacgagcgcttcccgcagtactggacgacgtat
tgggaactgcgttgccgcgacggcatctcgaaggagatggcgcgcgtcgagatgcgccgg
cgcctgacgctgatcggcgcgatgatggtgcggctcggcgatgcggacgggatgatctgc
gggaccgtcggcgaatatcacaaccacctgcgcttcgtcgacgaagtgatcggcaggaag
cccgatgcgtcgacctacgcggcgatgaacatcctgctgctgaaccagcggaccgtcgcg
ctcgtcgatacgcacgtcaacgacaaccccgatgcggagcagatcgccgaattcacgatc
gcggcggcgcgccagatggaatggctgaacctgacgccgaaggtcgcgctgctgtcgcgt
tcgaacttcgggtcggggagcgcggcgtcgggcgcgaagatgcgcaacgcgctggagatc
atccgcgcgcaggcgccggacatccaggccgacggcgagatgcacggcgactgcgcgctc
gacgagtcgctgcgcttgcggctgctgccgatgtcgccgctcaagggcgcggcaaacctg
ctcgtgtgcccgaacgtcgacgccggcaacatcgcgtacaacctgctcaagaccgaagcg
ggcagcaacgtcgcggtcgggccgttcctgctcggcgtcaatgcgccggtgaacatcctc
acgtcgagcgcgaccgtgcggcggatcgtgaacatgaccgcgctgacggtgatcgaggcg
aatcgcaacgcggcggcgtaa

DBGET integrated database retrieval system