KEGG   Burkholderia vietnamiensis LMG 10929: AK36_4232Help
Entry
AK36_4232         CDS       T03893                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00440  Phosphonate and phosphinate metabolism
bve01100  Metabolic pathways
bve01120  Microbial metabolism in diverse environments
bve01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AK36_4232 (aepX)
Enzymes [BR:bve01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AK36_4232 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AJY03936
LinkDB All DBs
Position
II:1393440..1395125
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSDQLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIEEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGAPHGRWIGLLNVR
GAGVERLKAMLATLQARADFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTANGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcgcgactgcgccgcatgctg
gtcagcgaccagctcgagttcctgatggaagcgcacaacggcctgtcggcacggatcgtc
cgcgaagccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gaagaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgccgaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagattctgcagttcgcgcgcgaatggagcggcaaagccccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcctccgcgatgcaggccgtcgcacgcgag
atccacgagaacgaaacgctgatcaacgtcgaggaccgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgtgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctggtcgtgaacgagcgccatgcgcagacg
ggcgagctcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggcggag
ttcagcgtcgtcgtcgattcgtcgctgaccgaaaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggcggccgacgatcgcgggctgttcggccagaagacgtatctgcaacgcgtg
tcgagcgacgttgccgccggcgcgccgcacggccgctggatcggcttgctgaacgtgcgc
ggcgcgggcgtcgagcggctgaaggcgatgctcgcaacgctgcaggcgcgcgccgacttc
gacacgctcgacatcccgtcgctgctcaacgagctgatcgccgccggcgagaagatcgaa
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgtcgcgcg
ggcgacttcgcgcacggccagacgccgctgtcggagccgggcaccgccaacggaggcgcg
caatga

DBGET integrated database retrieval system