KEGG   Burkholderia vietnamiensis LMG 10929: AK36_4265Help
Entry
AK36_4265         CDS       T03893                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Brite
KEGG Orthology (KO) [BR:bve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AK36_4265 (ahpF)
Enzymes [BR:bve01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AK36_4265 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like K_oxygenase NAD_binding_8 DAO FAD_oxidored Thi4 AlaDh_PNT_C Glutaredoxin FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: AJY03692
LinkDB All DBs
Position
II:1433878..1435476
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDGAKSRELLALLNEIASLTSRVTVIERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDFA
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQDEVDARQIMAVPTMFLNGAT
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLVVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFAAALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGNKL
NALVYKDLQSGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPVTTAAPQPAEALAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcaactgaaagcgtacctcgaaaagatcacccgcccg
atcgaactcgtcgcctcgctcgacgacggtgcgaaatctcgggaactgcttgcgctgctg
aacgagattgcgtcgctgacgtcgcgcgtgaccgtcatcgagcgccgcgacgatgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
attccgatgggccacgaattcacgtcgctcgtcctcgcgctgctgcagaccggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagattcgcgcgctcgacggcgacttcgcg
ttcgaaacgtatttctcgctgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcactgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
gatgaagtcgacgcgcgccagatcatggccgtcccgacgatgttcctgaacggcgcaacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacaccggcgcgagc
gcacgcgccgccaagtcgctcgaaaacaagccggtgttcgacacgctggtcgtcggcggc
ggcccggccggcgcggccgcggcgatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggccatcgaaaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgcggccgcgctcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaggcgctgatccccggcgacgtgcatcag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgttctcgcgaccggtgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaaccgcggcgtcgcctac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggcggcggc
aactccggcgtcgaggcggcgatcgacctcgccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcacaactgcgcgccgacgaggtgctgcaacgcaagctgcgcagcctgccg
aacgtcacgatcgtcacgcaagcgcagacgaccgagctgaccggcgacggcaacaagctg
aacgcgctcgtctacaaggatctgcagtcgggcgaaacgaaacgtatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaagggacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcccgcggggcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggttccgttcaagcagatcgtgatcgcggtcggcgaaggt
gcgaaggcatcgctcggcgcgttcgatcacctgatccggcaggacgcgacgccggtcacg
accgccgcgccgcagcccgccgaagcactcgccgcgtaa

DBGET integrated database retrieval system