KEGG   Burkholderia vietnamiensis LMG 10929: AK36_4979Help
Entry
AK36_4979         CDS       T03893                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
bve01130  Biosynthesis of antibiotics
bve01230  Biosynthesis of amino acids
bve02024  Quorum sensing
Module
bve_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AK36_4979
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AK36_4979
Enzymes [BR:bve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AK36_4979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AJY04173
LinkDB All DBs
Position
II:2248778..2249908
Genome map
AA seq 376 aa AA seqDB search
MHNLDNPSHDREVGSADATQDTTRIDDVRIGAVRPLISPALLQDELPVPAGTQTLVEDTR
RAIGDILHGRDDRLLVVVGPCSIHDHDQALEYARRLKAAADALQDDLLITMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRAARQLLLDINALGLPASTEFLDLLSPQYIADLIAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVAARASHAFMGMTKMGMAAI
FETRGNDDAHVILRGGKNGPNYDAEHVEASCAVLRKSGLREQVMVDCSHANSNKSHERQI
DVAQDLARQLSQGEQRIIGVMVESHLEAGRQDLKPGVPLKYGVSITDACLSWSQTEPVLD
VLAQAVRQRRGASRNA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcataacctcgacaatccctcccacgatcgcgaggtaggcagcgccgacgcgacgcaa
gacacgacccgcatcgacgacgtccgcatcggcgccgtgcgcccgctgatctcgcccgcg
ctgctgcaggacgagctgccggtgccggccggcacgcagacgctcgtcgaggacacgcgg
cgcgcgatcggcgacatcctgcacggccgcgacgaccggctgctggtcgtcgtcggcccg
tgctcgatccacgaccacgaccaggcgctcgagtacgcgcgccgcctgaaggccgccgcc
gacgcgctgcaggacgatctgctgatcacgatgcgcgtgtacttcgagaagccgcgcacg
acggtcggctggaagggctacatcaacgatccgcgtctggacggcagcttccgcatcaac
gaagggctgcgcgcggcacgacagctgctgctcgacatcaacgcgctcggcctgccggcg
tcgaccgaattcctcgacctgctgagcccgcagtacatcgcggatctgatcgcgtggggc
gccatcggcgcgcgcaccaccgagagccagagccatcgtcagctcgcatcgggcctgagc
tgcccgatcggcttcaagaacggcaccgacggcggcgtgcaggtcgcggccgatgcgatc
gtcgccgcgcgcgcgagccacgcgttcatgggaatgacgaagatgggcatggccgcgatc
ttcgagacgcgcggcaacgacgacgcgcacgtgatcctgcgcggcggcaagaatggtccg
aactacgacgccgagcacgtcgaagcgagctgcgcggtgctgcgcaagagcgggttgcgc
gagcaggtgatggtcgattgctcgcatgcgaactcgaacaagtcgcacgagcggcagatc
gacgtcgcgcaggatctcgcgcgccagctgtcgcagggcgagcagcgcatcatcggcgtg
atggtggagagccatctcgaggccggccgtcaggatctgaagccgggcgtgccgctgaag
tacggcgtgtcgatcaccgatgcatgtctgagctggtcgcagacggagccggtgctcgac
gtgctcgcgcaagccgtgcggcagcgccgcggcgcgtcgcgcaacgcgtga

DBGET integrated database retrieval system