KEGG   Burkholderia vietnamiensis LMG 10929: AK36_5296Help
Entry
AK36_5296         CDS       T03893                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00500  Starch and sucrose metabolism
bve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AK36_5296 (treS)
Enzymes [BR:bve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AK36_5296 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AK36_5296 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459
Motif
Other DBs
NCBI-ProteinID: AJY08365
LinkDB All DBs
Position
III:complement(346108..349518)
Genome map
AA seq 1136 aa AA seqDB search
MKREDSLDDVRRAQFASVAPAGTARARRARRREPALSTDDPLWYKDAIIYQVHVKSFYDS
NNDGIGDFPGLIMKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRGVHPDYGTLADVR
RFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSTHRDYYVWSDTDTKYAGTRII
FLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPILDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSERD
LLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLLN
WTRRILATRRATQVFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELDL
SEFAGRVPIEMTSDSPFPPIGQLTYLLTFPPYGFLWFVLSEHGREPSWRQPQAEPLPEYV
TIVMRRGEQRPDVGQLHTLAHDALSSWLTRRRWFASKDRKIGDARLNVVTPMPDEPFQYA
EAWVTTHGGDVERYVVPLAAAWGGETSNPLFAQLALARVRRGHTVGHLTDAFALPAFGRG
MLRMLRDGATVPTSDGGRLEFLPEQALAALDPGDDAEVRWLAAEQSNSSLVIGDAIVLKL
VRKVAHGVHPEAEMSRYLTRIGYANTATLAGEVVHVDPDGTPHTVAILQRYVDNQGDAWT
RSFDFLKRAIDELALPAVGDGEPAERDGEPDALLGYAAFAGVVGTRLGELHVALAQPSDD
AAFAPERATPEHVDGWCVDAIASFGHALDVLATRLDALDPSARDAAETLLASRDAAVQAL
GALVPRTLDAVCTRIHGDFHLGQVLDVQGDALLIDFEGEPARALERRRAKSHPLRDVAGL
LRSLSYVSATAQFAIEKVPPQAAGRKRALFDRFGQAAADRFVECYRAAAEHAPERFVDPR
YADRLLALFLIDKASYELCYEAANRPDWLGVPVGGLAALVERLLDAHAASDHGGTR
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagattccctcgacgacgtgcgccgcgcgcagttcgcgtccgtcgcaccg
gccggcaccgcgcgcgcgcgccgcgcgcggcgccgcgagcccgcgctgagcacggacgat
ccgctgtggtacaaggacgcgatcatctatcaggtgcacgtgaagtcgttctacgactcg
aacaacgacgggatcggcgacttccccggcctgatcatgaagctcgactacatcgccgag
ctgggcgtcgacacgatctggctgctgccgttctatccgtcgccgcgccgcgacgacggc
tacgacatcgccgactatcgcggcgtgcatccggactacggcacgctcgccgacgtgcgc
cgcttcatccgcgaggcgcatgcgcgcggcatccgcgtgatcgccgagctggtgatcaat
cacacgtccgaccagcacccgtggttccagcgcgcgcggcgcgccaagcccggctcgacg
catcgcgactactacgtgtggtccgacaccgacacgaagtatgcgggcacgcgcatcatc
ttcctcgatacggaaacctcgaactggacccacgatccggtcgccggccagtactactgg
caccgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgcgag
gtgatccaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgacgcg
gtgccgtatctggtcgagcgcgaaggcaccaacaacgagaacctgcccgagacgcacgcg
atcctgaagcggatccgcgcgacgatcgacgccgagtatccgaaccgcatgctgctcgcg
gaagcgaaccagtggccggaagacgtgcaggagtatttcggcaacgaggacgaatgccac
atggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggaccgc
ttcccgatcctcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgggcc
gtgttcctgcgcaatcacgacgagctgacgctcgagatggtgaccgactccgagcgcgac
ctgctgtggcagacctacgcgagcgaccggcgcgcgcggctgaatctcggcattcgccgc
cgcctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaactcgctgctg
ctgtcgatgcccggcacgccggtgatctactacggcgacgagctcgggatgggcgacaac
atccacctcggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtcggaccgcaac
ggcggcttctcgcgcgccgatccggaattgctggtgctgccgcccgtgatgggctcgctg
tacggctatgacgcgatcaacgtcgaggcgcagacgcgcgacccgcactcgctgctgaac
tggacccgccgcattctcgcgacgcgccgcgcgacccaggtgttcggccgcggcacgatc
cgcttcctgcgccccgagaaccgcaaggtgctcgcctacctgcgcgagctggacggccac
gagccggtgctgtgcgtcgcgaacctatcgcgcgcgtcgcaggcggtcgagctcgatctg
tccgaattcgcgggccgcgtgccgatcgagatgacgtcggactcgccgttcccgccgatc
gggcagctcacctacctgctgacgtttccgccgtacggcttcctgtggttcgtgctgtcc
gagcacggccgcgagccgtcgtggcggcagccgcaggccgagccgctgcccgaatacgtg
acgatcgtgatgcggcgcggcgagcagcggcccgacgtcggccagctgcatacgctcgcg
cacgacgcgctgtcgtcgtggctcacgcggcgccgctggttcgcgtcgaaggaccgcaag
atcggcgacgcgcggctgaacgtcgtcacgccgatgcctgacgagccgttccagtacgcg
gaggcatgggtgacgacccacggcggcgacgtcgaacgctacgtggtgccgctcgcggcc
gcatggggcggcgaaacgtcgaacccgctgttcgcgcagctcgcgctcgcccgcgtgcgg
cgcggccacacggtcggccatctgaccgacgcgttcgcgctgccggccttcgggcgcggg
atgttgcggatgctgcgcgacggcgcgaccgtgccgacttccgacggcggccgcctcgag
ttcctgcccgagcaggcgctcgccgcgctcgatcccggcgacgatgccgaagtgcgctgg
ctcgccgccgagcagagcaacagctcgctcgtgatcggcgatgcgatcgtgctgaagctg
gtgcgcaaggtcgcgcacggcgtgcatccggaagcggagatgagccgttacctgacgcgg
atcggctatgcgaacaccgcgacgctcgccggcgaggtcgtgcacgtcgatcccgacggc
acgccgcacacggtcgcgatcctgcaacgctacgtcgacaaccagggcgacgcgtggacg
cgctcgttcgacttcctcaagcgcgcgatcgacgagctggcgctgccggccgtcggcgac
ggcgagcccgcggagcgcgacggcgagcccgatgcgctgctcggctacgcggcgttcgcg
ggcgtcgtcggcacgcggctcggcgagttgcacgtcgcgctcgcgcagccgtcggacgac
gccgcgttcgcgccggagcgcgcgacgcccgagcacgtcgacggctggtgcgtcgacgcg
attgcctcgttcggccatgcgctcgacgtgctcgccacacggctcgacgcgctcgacccg
agcgcccgcgacgcggccgagacgctgctcgcgtcgcgcgacgcggccgtgcaggcactc
ggcgcgctggtgccgcgcacgctcgacgcggtctgcacgcgcatccacggcgacttccat
ctcggccaggtgctcgacgtgcagggcgacgcgctgctgatcgacttcgagggcgagccg
gcgcgcgcgctcgagcgccgccgcgcgaagtcgcatccgctgcgcgacgtcgccggcttg
ctgcgttcgctgtcgtacgtgagcgcgaccgcgcagttcgcgatcgagaaggtgccgccg
caggcggccggccgcaagcgcgcgttgttcgaccgcttcgggcaggcagccgcggaccgc
ttcgtcgagtgctatcgcgcggcggccgagcatgcgccggaacgcttcgtcgatccgcgc
tacgccgatcgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctctgctat
gaagccgcgaaccgccccgactggctcggcgtgccggtcggcgggctcgccgcgctcgtc
gaacgcctgctggacgcgcacgccgcgtccgaccacggaggcacccgatga

DBGET integrated database retrieval system