KEGG   Beta vulgaris (sugar beet): 104884254Help
Entry
104884254         CDS       T03548                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00564  Glycerophospholipid metabolism
bvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104884254
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104884254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox NAD_binding_8 GIDA Pyr_redox_3 FAD_binding_3 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 104884254
NCBI-ProteinID: XP_010667180
UniProt: A0A0J8B365
LinkDB All DBs
Position
Un
AA seq 626 aa AA seqDB search
MASSALRLRRIGAIAAAAAAATTTFTVTISSNDNRSVDPSIQTKIATSNGVVPPRRAHIS
SLVGSTPDKPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFASGTSSRSTKLIHGGV
RYLEKAVFNVDYGQLKLVFHALKERKQVIDNAPHLCHSLPCMTPCFGWFEVVYYWAGLKL
YDLVAGARLLHMSRYYSAQESIELFPTLKRMGDDKSLKGTVVYYDGQMNDSRLNVGLACT
ASLAGASVLNYAEVVSLLKDDVDGRIIGARIRDNISGEEFDTYAKVVINAAGPFCDFIRK
LVDKAAPPMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTLAGTTDSNT
ILTMLPEPHEDEIQFILDALSDYLCIKVRRTDVLSAWSGIRPLAMDPRAKNTESISRDHV
VCEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPANECITHNLILTGGSGWDPSNF
TVIAQQYVRMKQTRDGRVVPGVMDTAVAKHLSQAYGTLAERVASISQNEGLGKRLAHGYP
FLEAEVAYCARYEYCESATDFIARRCRLAFLDTDAAHQALPRVIEILTAEHKWDTSRKNY
EFKKAKEFLETFKSSKNAQFHDGKHK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcctcatcggctctccgcctccgccgaatcggcgccatagccgctgccgccgccgca
gcaacaaccacatttacagtgactatttcctcaaacgacaacaggagtgtggacccctca
atccagacaaagatcgccacctcaaatggcgtggtcccccctaggcgggcccacatctct
tctcttgtggggtccacccccgacaaaccccttgatattctcgtggtcggtggtggtgcc
actgggtgtggcgtcgcactcgatgccgtcaccagaggcctccgtgttggccttgttgaa
agggaggatttcgcctctggaacttcttccaggtctactaagttaattcatggaggagta
cgctaccttgagaaagctgtgttcaatgttgattatgggcaactaaagcttgttttccat
gcactcaaggaacgtaaacaggtgattgataatgctccacatctgtgccactctttgcct
tgcatgaccccgtgttttggctggtttgaagtggtgtactactgggcaggcttgaaacta
tatgatctggtagcaggggcaaggttgctacatatgtcgaggtattactcagcgcaagag
tctattgaactcttccccacgcttaaaagaatgggagatgataaaagtttaaagggaact
gtagtttattatgatgggcaaatgaatgactcgagactgaatgttggcttggcgtgcaca
gcgtcattagctggtgcctctgttcttaattatgctgaagttgtttccttactcaaggat
gacgttgatgggaggataattggtgcacggattcgtgacaatatctctggtgaagagttt
gatacatatgctaaagttgtgataaatgctgctggacctttttgtgattttatccgaaaa
ctggttgataaggctgctcctccaatgatttctcctagcagcggtgtacatattgttctc
cctgactattattctccagaagggatggggttaattgttcccaaaactaaggatggccgt
gttgtttttatgcttccatggctgggaaggacattagcagggaccacggattctaatacc
atccttacgatgttgccagaaccacatgaggatgagattcaatttatcttggacgctctc
tctgattacctctgtatcaaggtacgtcgaacagatgttctctctgcatggagtggcatt
cgcccattggcaatggatccaagagcgaaaaacacagaaagcatatctcgtgatcatgtt
gtttgtgaagatttccctggcttggtaactattactggtggaaaatggaccacctataga
agcatggctgaggatgctgttgatgctgcaattaaatctggaaagcttagtccagctaat
gaatgcataacacacaacttgatacttacgggtggctctggttgggatccctccaatttt
actgttattgctcaacagtatgttcggatgaagcagacacgtgatggaagagtcgttcct
ggtgtcatggacactgctgtagcaaagcatttatcgcaagcatatggtacattggctgag
cgggtggcttcaatatctcagaatgaaggtttgggcaagcgtctcgcacatggataccct
ttccttgaagcggaagtagcatactgtgctcgatacgagtattgtgagtctgcaactgat
tttattgcacgtagatgccggcttgcttttctagatactgatgcggctcatcaggctctg
cctcgtgtcattgagatactaacggcggagcataaatgggatacatctagaaagaattac
gagtttaagaaggctaaggaattcctggagaccttcaaatcatccaagaatgctcagttt
catgacggtaaacacaaatag

DBGET integrated database retrieval system