KEGG   Beta vulgaris (sugar beet): 104888351Help
Entry
104888351         CDS       T03548                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00052  Galactose metabolism
bvg00500  Starch and sucrose metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104888351
   00500 Starch and sucrose metabolism
    104888351
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104888351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104888351
NCBI-ProteinID: XP_010671591
LinkDB All DBs
Position
3
AA seq 898 aa AA seqDB search
MERSQLLASPLTLVVVSLLVSCMVTIQTKAAAKPENGGQGEVIGYGYKVKYAKIDNSTGR
SLVALLQLIRNSSVYGPDIQLLSLTVSLDEDDRLRIRINDANQPRWEIPYNILPRPPPPP
PPSQPPQHHLNPPTTTFTHPNSDLTFSLHNTSPFGFSISRKSTNDILFNATPDPTNPTTF
LIFKDQYLQLSSSLPAHKAHLFGLGEHTKPTFQLAHNQTFTLWNADTASFNEDVNLYGSH
PFYMDVRSSPVVGSTHGVLLLNSNGMDVEYVGDRITYKVIGGIIDLYIFAGPTPEAVLDQ
YTQLVGRPAMMPYWAFGFHQCRWGYHDINEVESVVDRYAEAKIPLEVMWTDIDYMDAFKD
FTLDPVNFPLGKMQQFVSKLHNNGQRYVLIIDPGISTNNSYGTFIRGMQSDVFIKRDGKP
YLGAVWPGPVYFPDFLKPAAQNFWVDEIKRFRDLVPFDGLWIDMNEISNFVTSTPTPGSS
LDNPPYKINNNGAQVSISKNTMPATALHYGNITEYNAHNLYGYLEARTTHDALIAATKER
PFVLSRSTFVGFGKYAAHWTGDNAAKWADLAYSVPAILNFGLFGIPMVGADICGFNGDTT
EELCRRWIQLGAFYPFSRDHSEKNSIHQELYMWDSVAISARKVLGLRYQLLPYFYTLMYE
ANLRGTPIARPLFFTFPEDTTTYGISSQFLIGRGMMVSPVLKPEAVSVDAYFPRGNWFDM
FNYSQSVSVSTGTTVTLSAPPDHINVHIREGNIVAMQGEAMTTRAARKTPFHLLVVMSDH
GASTGEIYLDDGVDVKKDSKKGGWSWVTFGAKLEPNSVTISSNVTEGEYAKSQKWVIDKI
TILGLRKRVNLKNGVDRTLKGEGMRLSSTSNINGKFVVSEVSNLKLLIGQNFNLELKY
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggaacgatcacagttattggcatcgccattgacattagtagtggtgtcactactagtg
tcgtgcatggtgacgatacaaacgaaggcggcggcgaaaccggaaaatggtggtcaggga
gaagtgattggctacgggtacaaagtgaagtatgccaaaattgataactccacaggaaga
tccttggttgccttgttgcaacttatcaggaattcctctgtttatggccctgatattcaa
cttcttagtcttactgtcagtctcgacgaagacgatcgtttaaggattcgaatcaacgac
gccaaccaacctcgatgggaaatcccctacaacatcctccctcgtccaccaccaccacca
ccaccatcacaaccaccacaacaccacctcaatccacccacaaccaccttcacacaccca
aactccgacctcacattctctctccacaacacatctccttttggtttctccatctcacgc
aaatccaccaatgacattctcttcaacgccacacctgaccccaccaaccccaccactttc
ctcattttcaaggaccaatatcttcaactttcttcttcccttccggcccacaaagcccac
ctctttgggcttggagaacacaccaagcccaccttccagttggcccataaccagaccttc
acactttggaatgctgacactgctagcttcaatgaggatgttaacttatatgggtcccac
cctttttacatggatgttagatcttctcctgtggtggggtccactcatggagtattgttg
ttgaatagtaatgggatggatgttgagtatgttggagataggattacttataaggttatt
gggggtattattgacctttacatctttgctgggccaactcctgaagcagttcttgatcaa
tatactcagctcgtgggccggcctgctatgatgccttattgggcttttggatttcatcaa
tgccggtggggttatcatgatataaatgaagttgagtccgtggtagataggtatgcagaa
gctaaaattcctttggaagtaatgtggactgatattgattacatggatgccttcaaagat
tttactctagatcctgttaattttcctctgggaaagatgcagcaatttgttagtaaactt
cacaataatgggcaaagatatgtgcttatcattgatcctggtattagtacaaataactcc
tatggaacttttattagagggatgcaatctgatgtgtttatcaagcgagacggtaaacca
tacctgggtgctgtatggccgggaccagtttactttcctgattttttgaaacctgctgct
cagaacttttgggttgatgagattaagagatttcgagatcttgttcccttcgatggactg
tggattgacatgaatgaaatatcgaactttgtcacttccacaccaaccccaggatctagc
cttgacaatccgccttataagatcaataataatggagctcaggtttccatatcaaaaaat
actatgccagcaacagctttgcactatggtaatatcacagaatacaatgctcataaccta
tatggataccttgaagctcgaactacccatgatgcactcattgcagctaccaaagaaagg
ccatttgtactttcgagatcaacatttgttggctttggaaagtatgctgcacattggacc
ggagataatgctgcaaaatgggctgacttggcatattcggttcctgctatattgaacttt
ggactttttggaataccaatggttggagctgatatatgtggtttcaatggagacacaaca
gaagagctttgtcgtcggtggatacagctgggtgccttttatccattttcaagagaccat
tcagaaaaaaatagcatccaccaggagctgtatatgtgggactctgttgctatttctgca
agaaaagtgctcggactccgctaccagcttctcccctacttctatacattgatgtatgag
gcaaacttgagaggaacccccatagcgcgacccctattctttactttcccagaggacacc
acaacttacggaataagctcacagtttctcatcggcagaggaatgatggtttcacctgtt
ctgaagcctgaagcagtttctgttgatgcatactttccacgaggaaactggttcgatatg
ttcaactactcgcaatcagtcagtgtatctacaggaacaactgttactctcagtgcaccc
cctgatcatatcaatgttcacatccgagaaggtaatattgtggctatgcaaggtgaagcc
atgacaacacgagccgcgaggaagacaccatttcatctcttggttgttatgagtgatcat
ggtgccagcaccggtgagatttacttggacgacggcgttgatgtgaagaaggacagtaag
aaaggagggtggagttgggtgacatttggtgcaaaattggaaccaaatagtgtaactatc
tcatcaaatgttacggaaggagaatatgctaagagtcaaaaatgggtgattgacaaaata
accattttgggtctaagaaaaagagtgaacttaaaaaatggcgttgatcgaactttgaag
ggtgaaggaatgagactaagctcaacttctaacataaatgggaagtttgttgtgtctgaa
gtctcaaatttgaaactgctcattggacagaactttaacttggagctgaagtactga

DBGET integrated database retrieval system