KEGG   Beta vulgaris (sugar beet): 104889901Help
Entry
104889901         CDS       T03548                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00061  Fatty acid biosynthesis
bvg00780  Biotin metabolism
bvg01100  Metabolic pathways
bvg01212  Fatty acid metabolism
Module
bvg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104889901
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    104889901
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    104889901
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bvg01004]
    104889901
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     104889901
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     104889901
Lipid biosynthesis proteins [BR:bvg01004]
 Fatty acid synthase
  Component type
   104889901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 104889901
NCBI-ProteinID: XP_010673539
LinkDB All DBs
Position
4
AA seq 391 aa AA seqDB search
MAVSTASGLQMAAVKPCVFAQNQVMKAGAAFFSADLKQASFAKLSSACHISSLKPFQRNF
SAASSKSNSNVIKAMAESSDKPVGGLPINLKGKRAFIAGVADDNGYGWAIAKSLAAAGAE
ILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDTLEDVPEEIKTNK
RYAGSSNWTVKEVVESVKQDFGSIDILVHSLANGPEVTKPLLETSRNGYLAAISASSYSY
VSLLKHFLPIMNPGGSSLSLTYIASERIIPGYGGGMSSAKAALESDTKVMAFEAGRKRRI
RVNTISAGPLRSRAAKAIGFIDMMIDYSIANAPLQKELSAEEVGNAAAFLASPLASAITG
AVIYVDNGLNAMGVGVDSPIFENLDIPKDQL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcaacagcttcagggttacaaatggcggcagtaaagccgtgtgtttttgcg
caaaaccaagttatgaaggctggtgctgcattttttagtgctgatttgaaacaggcttca
tttgctaagcttagtagtgcttgtcatatatcatctttaaagccctttcagcgcaatttc
tcggctgcatcgtcgaaatcgaactcgaatgtgattaaggcaatggcggaatctagtgat
aagcctgttggaggattgcctattaacttaaaaggtaaaagggcatttattgccggcgta
gctgatgataatggatatggttgggcaattgcaaaatccctagctgctgctggtgctgag
attcttgttggcacttgggtccctgcgctgaatatttttgaaacaagtctaagacgtggg
aagtttgatgaatcacgggtattgcctgatggttccttgatggagatcaccaaagtatat
cctctagatgcagtctttgatactcttgaagatgttcctgaagagataaaaaccaacaag
cgttatgcagggtctagcaattggactgttaaggaagttgttgaatcagttaaacaggat
tttggtagcattgacatccttgtgcattcattagccaatggacctgaggtcaccaaacct
cttttagaaacatcaaggaacgggtacctagcggctatatctgcttcaagctactcttat
gtttcattgctgaaacatttccttcctataatgaacccaggtggttcttcattgtcactc
acctacattgcttctgagaggattattcctggttatggtggaggcatgagttctgcaaaa
gctgcactagagagtgatacaaaggtaatggcttttgaagcgggtaggaaacgcaggatt
agagtgaacacaatatcagctggcccactccggagtcgtgctgcaaaggctattggattt
attgatatgatgattgactattctatagcaaatgctccattgcaaaaagaactatctgca
gaggaagttggaaacgcggctgctttcttagcgtcacctttggcatctgctataacaggt
gctgtaatttacgtcgacaatggtctgaatgcgatgggagtaggtgtagatagtcctatt
tttgaaaatcttgacattcctaaagaccagctctag

DBGET integrated database retrieval system