KEGG   Beta vulgaris (sugar beet): 104891340Help
Entry
104891340         CDS       T03548                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ATXR4
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00310  Lysine degradation
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104891340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bvg03036]
    104891340
Enzymes [BR:bvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     104891340
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     104891340
Chromosome and associated proteins [BR:bvg03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104891340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-FLZ
Motif
Other DBs
NCBI-GeneID: 104891340
NCBI-ProteinID: XP_010675323
LinkDB All DBs
Position
4
AA seq 331 aa AA seqDB search
MSSLLRTSRYLFPQLKLLISPTNPLLKISISTISTTNNVREEKSQAGPPPIQVGITETAG
RAVFATRKIGASELIHTAKPIISHPSLTKIGSVCYLCLKRLKPEAGTENNSRIRVEPFCT
EECRQQAKAYYEIEKKADWSAYHKYCRTSSLKYPLLVKRLACMVIAGAASADCIHILQPA
PVLPETEVEYSMLRSAFEGINMAEENFKFLSEQWYADVLARIRINAFRIEMVAGSYDDLL
TLAAASVEAEAGVGNAVYILPSFYNHDCDPNVHIIWMDSVHARLKALRDIEEGEELRICY
IDASMDHNARQSILLGGFGFKCSCHRCLSGD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgttattacgaactagccgttacttgtttcctcaattgaaactactaatttcc
cccacaaacccacttttgaaaatttctatttccaccatttcaacaaccaataatgtcaga
gaagaaaaatctcaagcaggacctcctccaatccaagttgggatcacggagacagcaggt
cgagcagttttcgccactcgaaaaatcggagcttctgagctcattcacactgcaaaaccc
atcatttctcacccttctctcaccaaaattggcagcgtttgttacctttgccttaaaaga
ttaaaacctgaagccggaaccgaaaacaattctcgaattcgggtggaacccttttgtacc
gaagaatgccggcaacaagctaaggcatattatgagatagagaagaaagcagattggtcc
gcttaccacaaatactgcagaacttcgagtttgaagtatccacttctggtgaagcggttg
gcttgtatggttatagctggagcagcatctgcagactgcattcatatacttcaacctgct
cctgttctgcctgagacggaagtggaatacagcatgctaaggagtgcttttgaaggaatt
aatatggcagaggaaaacttcaaatttttatcagaacaatggtacgctgatgtgctggct
cgaatacgcattaatgcatttcgaattgaaatggttgctgggtcatatgatgatcttctc
acactggcagcagcttcagtagaagctgaagctggagttgggaatgctgtgtatattctt
ccttcattctacaatcatgattgtgatccgaatgtgcatattatatggatggactctgtt
catgcaaggttgaaagcactccgtgacatagaagaaggtgaagagcttcggatatgttat
attgatgctagtatggatcataacgctcgccaaagcattcttttaggaggatttggtttc
aagtgctcttgtcatcgttgcctgtccggtgattag

DBGET integrated database retrieval system