KEGG   Beta vulgaris (sugar beet): 104891399Help
Entry
104891399         CDS       T03548                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00620  Pyruvate metabolism
bvg00710  Carbon fixation in photosynthetic organisms
bvg01100  Metabolic pathways
bvg01200  Carbon metabolism
Module
bvg_M00168  CAM (Crassulacean acid metabolism), dark
bvg_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
bvg_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
bvg_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104891399
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104891399
Enzymes [BR:bvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     104891399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 104891399
NCBI-ProteinID: XP_010675388
LinkDB All DBs
Position
4
AA seq 967 aa AA seqDB search
MMARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC
YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDENSATTESDIEETFKRLVGQLGKTPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYYAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFELSMFRCSDELRVRALELHSSSRKDAKHYIEFWKYI
PPNEPYRVILGDVRDKLYNTRERSRQLLSHGMSDIPEDTTYTDVALFLEPLELCYQSLCA
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITTHLEIGSYKEWSEEQ
RQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFNVIAELPSDCFGAYIISMATSPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKDRINGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIN
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPRPEWRALLDEMAVVAT
EKYRSIVFKEPRFVEYFRLATPETALGSMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFSYAIQQDDKNLYMLEQMYNEWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEELWPFGERLKTDYEATKKLLLKIAGHKEILEGDPHLRQRLRLRDPYITTLNVCQ
AYTLKRIRDPNYHVQLRPHISKEYIDSTSKPAAELVKLNPSSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcgtaatattgaaaaaatggcgtcgattgatgcccaacttaggcttttagtt
cctgcaaaagtttctgaagatgataagttgatcgagtatgatgctcttttgctggatcga
ttccttgatattcttcaggatttacatggggaagatcttcgtgaaactgtccaagaatgt
tatgaactttcagctgaatatgaaggtaaaagggatcctaagaagcttgaagagcttggg
aatgtgctcacaagcttggatccaggggactccattgttgttgctaagtctttctctcac
atgcttaacttggccaacttggctgaggaggttcagattgcttaccgtcgtagaatcaag
aagctgaagaagggagatttcgtcgatgagaattcagcaactactgaatctgatattgag
gagacatttaagaggctagtagggcagcttggaaaaaccccggaagaaatttttgatgcc
cttaagaatcagactgtggatcttgtcttaactgctcaccccactcaatctgtccgtaga
tcattgcttcagaagcatggaaggataaggaattgtttggcccaactatatgcaaaggat
atcactcctgatgacaagcaggagctcgatgaagctttacagagagagattcaagcagcg
tttcgtactgatgaaattcgaaggacacagcccacacctcaggatgagatgagggctgga
atgagctactttcatgaaacaatttggaagggtgttcccaagtttttacgtcgtgttgat
actgctttgaagaacattggcataaatgagcgtgttccctactatgctcctctgatccaa
ttttcctcttggatgggtggtgatcgtgatggtaatccaagagtgacacctgaggtcaca
agggatgtatgcttgttagctagaatgatggcagctaacctctacttttctcagatagag
gatctcatgtttgagttatccatgttccgttgcagtgatgaacttcgtgttcgtgccctt
gagctccacagctcctctagaaaggatgccaagcattatatagagttttggaaatatatt
ccaccaaatgaaccatatcgtgtaattcttggtgatgtgagagataaattatataataca
cgtgagcgttctcgccagctgctatcccatggaatgtcagatatcccagaagatacaact
tacaccgatgtggcactgtttttggagcctcttgagctttgctaccaatccctctgtgcc
tgtggtgaccgaccaattgctgatggtagcctccttgatttcttgagacaagtttccact
tttggtctctcacttgtaagacttgatattcgccaagagtcagatcgtcacactgatgtc
atggatgctattaccacacacttggaaattgggtcctacaaggaatggtccgaagagcag
cgtcaagaatggctcttatcagaattaagtggaaaacgcccattgtttggtcctgatctc
cccaaaactgaagaaattgctgatgtcttggacaccttcaatgtcattgcagaacttccg
tcagattgttttggagcttatattatttcaatggctacatcaccttctgatgtgcttgca
gttgagcttcttcaacgtgaatgtcatgtgaagaagccactgagggttgtgcctttgttt
gagaaacttgctgatcttgaagccgctcctgctgcagtggctcggctattctctattgat
tggtataaagaccgaattaatggtaagcaagaagttatgattggatattcagattcaggg
aaggatgctgggcgtctctcagcagcatgggcactgtacaaagcgcaggaggagcttgtg
aaggttgctaaggaatatggtgtgaaactcaccatgttccatggtcgtggaggcactgta
ggaagaggaggtggacctacccatcttgctattttgtctcaacctccagagacaattaat
gggtcacttcgtgttacggtgcaaggtgaagttattgagcaatcatttggggaggagcac
ctgtgctttagaactcttcagcgtttcactgctgccacccttgagcatggtatgcaccca
cctatctccccgagacctgaatggcgtgcccttttggatgagatggcagttgttgccact
gagaaataccgctccattgttttcaaagaacctcgttttgtggagtatttccgtctggcc
accccagagacagcattgggtagcatgaacattggaagtcgtccttcaaaaagaaagcca
agtgggggtatcgaatcacttcgtgccatcccatggatctttgcgtggactcagacaaga
tttcatcttccagtgtggcttggatttggagcagcattcagctatgccatccagcaagac
gataaaaatctctacatgcttgagcagatgtacaatgaatggccattctttagggtgact
attgatttagttgagatggtgttcgcaaagggagatccagggattgctgctttatatgat
aagctacttgtctctgaagagttgtggccttttggagagcgcttgaagacagactatgaa
gcaacaaaaaagcttctgctcaagattgctggacacaaagaaattctggagggcgatcct
cacttgaggcaaagacttcggcttcgtgatccttacattacgaccttgaatgtgtgccaa
gcctacactctgaaacgtattcgagaccccaactaccatgtccagttgagaccccacatc
tctaaggagtacatagattctaccagcaaacctgctgctgagcttgtgaagttgaaccct
tcaagtgaatacgctccaggtcttgaagataccctcatcctcaccatgaagggtattgca
gccggaatgcagaacaccggttga

DBGET integrated database retrieval system