KEGG   Beta vulgaris (sugar beet): 104893011Help
Entry
104893011         CDS       T03548                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104893011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bvg03036]
    104893011
Enzymes [BR:bvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104893011
Chromosome and associated proteins [BR:bvg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104893011
   Polycomb group proteins
    PRC2-EZH2 complex
     104893011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 104893011
NCBI-ProteinID: XP_010677348
LinkDB All DBs
Position
5
AA seq 914 aa AA seqDB search
MSAKPSRSNSVSISRSELSKVTPVLEPANMSVVPKEIISVIDSLKQQVEAQRHVYIQNIM
EENRQKLSRVTLAKERRNITVTDTEKSTALLVKRQNDAINMQNGIEGGKKGEDGSGSQEH
AAVLLGASIPIKNTVRAIRLPEVKRLPPYTTWMFLDRNQRMTEDQSVLGRRRIYYDPTGG
EALICSDSEEEVIEEEEDKKEFVRSEDHILRNTVQQVGLSDAVLDLLGQCFSKKPTDIKA
RYEALCEEEKAKTGLGNGDTVETSEYSNPYIDKDLEGALDSFDNLFCRRCYVFDCRLHGC
SQDLIFPTEKQHPWNSPEEANVPCGPLCHRSAPKCEGDSAAISQKCDGFKAKPSLSSNDT
SIEVSPRNKFTGSSNKRKGKSTPSESASSNARNASDSSDSDERLAQDKNSIDQSSIQPET
KSIGKSGTRKNKYKRAAERILVAMQKRHKMLAQDADSVNAGSTLSSDMKLRSRTRKEDEV
ASSSSQKKGTLSTDERSRTGFPALGSSKSLNAPSDVLNIGSNDQSTVNLDDVSRKEEIVD
ESPGKVEVNIDKSWKALEKALYEKGLEIFGRNSCLIARNLLNGLKTCSEVYNYMTHLNSK
LSIEGRDDGTNLECNDPMGNEVRRRSRYVRRRGRVRRLKYTWKSTGYHSIRKRISERKDQ
PCRQYNPCGCESACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFA
ADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYGCRNMKLLLKQQQRVLLGRSDVSGWGAF
LKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFA
NHSPDPNCYAKVIMVAGDHRVGIFAKERMNAGEELFYDYRYEPDRAPAWARKPEESGSKK
DAAGPSSGRAKKLA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaaaccgtcgcgctccaattctgtttctataagcagatcggagctttccaag
gttacgccggtgttagagcctgcgaacatgagcgtggtaccgaaggagattatttcggtt
atcgattcgttgaagcagcaagtagaagctcaacgccatgtttatattcagaacataatg
gaagaaaacaggcaaaagttgtctagggtgactttagcaaaggaaagaagaaatatcacg
gttactgacacagaaaaaagtactgctttactggttaagaggcagaatgatgcgatcaat
atgcaaaatggcatcgaaggaggtaaaaagggtgaagatggcagtggctcacaagaacac
gcagcagttcttctgggggcgtctatccctattaagaatacagttcgagccattagactc
cctgaagtgaagagactgccaccttatactacatggatgtttttggacagaaaccaaagg
atgacggaagaccaatctgtgttaggtcgaaggagaatttattatgatccaactggtggg
gaagctttaatatgcagtgacagtgaagaagaagtaattgaggaagaagaagacaagaag
gaatttgttcgatcagaagatcacatcttgcgaaatacagtgcagcaagttggtttatca
gatgctgttttggatttactgggacagtgcttttccaagaaacctactgacatcaaggca
agatatgaagctctttgtgaggaagagaaggctaagacaggtctagggaatggggatact
gtagagacttcagagtattcaaacccatatattgataaagatctggaaggagctttggat
tcatttgacaacttgttctgtcgccggtgttacgtttttgattgtagattgcatggatgt
tcacaggaccttatttttcctactgaaaaacaacacccgtggaattctccagaggaggcg
aatgtaccttgtgggccgctttgccatcgatcggctcccaagtgtgaaggtgattcagca
gccatctcccaaaaatgtgatggtttcaaagcaaagcccagcctttcgtccaatgatact
tctattgaggtgtcaccaaggaataaatttactggatcttctaacaagcggaagggaaaa
tccactccaagtgaaagtgcctcttcaaatgctagaaatgcatcggacagtagtgattca
gatgaaagacttgctcaagataagaactctattgaccaatcttctatccagccagagact
aagtcgattgggaaatctggaactcgcaaaaataagtacaagcgagctgctgaaaggata
cttgttgcaatgcagaagaggcataagatgttggcccaagatgctgattcagttaatgct
ggttctacgttgtctagcgatatgaagcttcgatctcggacacggaaggaggatgaagtg
gcaagttcttcttcacagaagaaaggaaccttaagtacagatgaaaggtcaaggacagga
tttcctgctttgggcagttccaagtctttaaacgctcctagtgatgttttgaatatagga
tctaatgatcaatcgacagttaatttggatgacgtgtcaaggaaagaagaaattgtagat
gaaagccctggaaaagttgaagtgaatattgataaatcttggaaggctcttgaaaaagcg
ctttatgaaaagggtttggagatattcggtaggaacagttgcttgattgctcgaaacctt
ttgaatggattgaagacttgctcagaggtctataactacatgactcacttgaatagtaag
ctatcaattgaaggtcgtgatgatgggacaaaccttgaatgcaatgaccctatgggtaat
gaagtcaggagaagatcaagatatgttaggaggagaggcagagttcgtcgtttgaagtat
acttggaagtccactggttatcattccatcaggaagcgaatttcagaaaggaaagatcaa
ccttgtcgacagtataatccttgtgggtgtgaatctgcttgtggaaagcagtgttcatgt
cttttaaatggcacatgctgtgaaaaatattgcgggtgtcctaagagctgcaaaaacaga
ttccggggctgccactgtgctaaaagtcaatgcagaagccgtcaatgtccatgtttcgca
gcagatagggaatgtgatccagatgtctgtcgtaattgttgggtgagttgtggtgatggt
acacttggtgtcccaaatcaaagaggggacaattatggatgtagaaatatgaagcttttg
ctcaagcaacaacagcgggttttacttggtaggtctgacgtgtctggttggggagcattt
cttaagaatagtgttggaaaacatgaatacctaggggagtacactggggagttaatctca
catcgggaagctgataagcgcggaaagatatatgatcgtgaaaattcttcatttctgttc
aatctaaatgatcagtttgtccttgatgcttatcggaaaggggataagctgaaatttgca
aatcattctcctgatccgaattgctatgccaaggttattatggtagctggagatcatcgg
gtggggatatttgccaaggaacgaatgaatgcaggggaagagctgttctatgattaccgt
tatgagcctgatcgagctccagcttgggctcggaaacctgaggaatctggatccaagaaa
gatgctgcaggcccctccagcggtcgtgcaaagaagcttgcttaa

DBGET integrated database retrieval system