KEGG   Beta vulgaris (sugar beet): 104896065Help
Entry
104896065         CDS       T03548                                 

Definition
(RefSeq) S-adenosylmethionine carrier 1, chloroplastic/mitochondrial
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvg02000]
    104896065
Transporters [BR:bvg02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   104896065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Gly-zipper_YMGG
Motif
Other DBs
NCBI-GeneID: 104896065
NCBI-ProteinID: XP_010681056
LinkDB All DBs
Position
6
AA seq 327 aa AA seqDB search
MGPVTLAIGGTKNSSMEQSDMSGPKVQKVSMGSKMCFASASMGEEKPFDFIQTLVDGIIA
GGTAGVVVETVLYPIDTIKTRLQAARGGGKIVLKGLYSGLAGNLAGVLPASAAFLGVYEP
TKQKLLRLLPENLSAVAHLTAGAAGGVAASLIRVPTEVVKQRMQTGQFTSAPDAVRLIVS
KEGFKGLYAGYRSFLLRDLPFDAIQFCLYEQIRLGYKLAAKRELNDPENAVIGAFAGALT
GAITTPLDVIKTRLMIQGSGNQYKGIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIF
FGVLESTKRFLSESREKRIESSEKKQA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgttacgttagccattggtggcacaaagaactcttcaatggaacagtcagat
atgtcggggccaaaagtgcagaaagtatcgatgggaagtaaaatgtgttttgcatctgcc
agcatgggagaagaaaagccctttgatttcattcaaacgttagtagatggtattattgca
ggaggtactgctggtgtcgttgtggagactgttttatacccaattgatactataaagaca
cgattacaggcagcacgtggtggagggaagattgttttgaagggtctttactctggattg
gctggaaatcttgcaggagtccttccagcatctgctgcgtttctgggtgtgtatgaaccg
acgaagcaaaagttgttgaggttgcttcctgagaaccttagtgcagttgcacatttgact
gcaggtgccgctggtggtgttgctgcttctctaattcgtgtacctactgaagttgttaag
cagaggatgcaaacagggcagtttacttcagctcctgatgctgtacgtctaattgtttca
aaggagggattcaaaggtctttatgcgggataccgatcatttttgctacgagatttaccc
ttcgatgctatacagttctgcctatatgaacagattcggctcggttacaagcttgcagcc
aaaagagaactgaatgatccggagaatgccgtcattggcgcttttgctggtgcgttaact
ggtgctataactacccctctcgatgtaattaagactaggctaatgatccagggatctgga
aaccagtacaaaggcattgtagattgtgtccagactattgttagggaagagggagcccct
gcccttttaaaggggattggaccaagagttttgtggatcggaattggtggctctatattc
tttggtgtacttgaaagcacaaagcggtttctttcagagtcacgagaaaagcgtattgaa
tcatcagagaaaaaacaagcttga

DBGET integrated database retrieval system