KEGG   Beta vulgaris (sugar beet): 104896518Help
Entry
104896518         CDS       T03548                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00010  Glycolysis / Gluconeogenesis
bvg00020  Citrate cycle (TCA cycle)
bvg00620  Pyruvate metabolism
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
bvg01200  Carbon metabolism
Module
bvg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104896518
   00020 Citrate cycle (TCA cycle)
    104896518
   00620 Pyruvate metabolism
    104896518
Enzymes [BR:bvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104896518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding ComFB
Motif
Other DBs
NCBI-GeneID: 104896518
NCBI-ProteinID: XP_010681572
LinkDB All DBs
Position
6
AA seq 482 aa AA seqDB search
MAASLTKLSLSNCNSNSPTISFSSSLSSSSTSLQWRPSTALPPKPRRKPAKVSAKIREIF
MPALSSTMTEGKIVSWSKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGET
APVGAPIGILAESEEEIDEAKARAAKSGSKSESPVSSETQIPAEIPAAVPAPPAPAEGGR
KGVATPFAKKLAKQHKVELNSVKGTGPFGRITPEDIEKAAGIVKPAPAIASPSSTPPPPP
PPPAAKVGSVSVGSFTEIEGSSVVPFTSMQAAVAKNMAESLSVPTFRVGYPIVTDALDAL
YEKVKKKGVTMTALLAKAAAMALVQHPVLYATCKDGKSFTYNSSINIAVAVAINGGLITP
VLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQ
GAIMAVGASKPTVVADSDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSNIIQNPDNL
TM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttctctcactaaattatctctctccaattgcaattccaattcccctacaatc
tccttctcatcttctctctcatcctcttccacctctctccaatggcgtccttccaccgca
ctccctcccaaaccccgccgaaagcccgccaaagtatccgccaaaatccgagagatcttc
atgcctgcactcagctctacaatgaccgagggaaagatcgtttcgtggtccaaatcggag
ggcgatgttcttagtaaaggcgaatcggttgtcgttgttgagtccgataaagccgacatg
gatgtcgaaacgttctacgatggaattctcgccgccattgttgtccctgaaggtgaaact
gcacctgttggagctcctattggtatcttggctgaatccgaggaagaaattgatgaggct
aaagctagggctgccaaatcaggatccaaatcggagtctccggtttcatcggaaactcaa
attccggcggaaattccggcggctgtgcctgctccaccggcgccggcggaaggagggagg
aagggagtggcgacgccatttgcgaagaagttggcgaagcagcataaggtggaattgaat
tctgttaaggggacagggccatttgggaggatcacgcccgaagatatagagaaggcggct
ggcattgtgaagccggcgcctgctattgcttcgccgtcttctactccgcctccacctccg
cctccacctgctgccaaggttggtagtgtcagtgttggtagttttactgagattgagggg
tcgtctgtggtgccgttcacttcaatgcaggcggctgtagcgaagaatatggcggagagt
ctgtcggtacctacttttcgggttgggtatccaatagtcactgatgcacttgatgctctt
tatgaaaaggttaagaagaagggggtgacgatgacggctttgctagcgaaagctgcagcg
atggcgctcgttcagcatcctgtgctgtatgctacatgtaaggatgggaagagctttact
tataatagtagtataaacattgctgttgcagtggcaatcaatggtggattgatcacacct
gtattgcaggacgcagacaagttggatctgtatctgttatcacaaaaatggaaagaactg
gtagagaaggctcgttcgaaacaattgcagcctcatgagtacaattcaggtactttcacc
ctgtccaatttgggcatgtttggggtagacagatttgatgctattcttcctccaggccag
ggagccattatggctgtgggagcatcaaagcctactgttgttgctgattccgacggtttc
ttctcagtgaagaataaaatgctggtgaatgtcacagctgatcaccggatcatctatggt
gccgacttggctgctttcctccagaccttttcaaatatcatccaaaatccagacaatcta
acaatgtag

DBGET integrated database retrieval system