KEGG   Beta vulgaris (sugar beet): 104897405Help
Entry
104897405         CDS       T03548                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00010  Glycolysis / Gluconeogenesis
bvg00053  Ascorbate and aldarate metabolism
bvg00071  Fatty acid degradation
bvg00280  Valine, leucine and isoleucine degradation
bvg00310  Lysine degradation
bvg00330  Arginine and proline metabolism
bvg00340  Histidine metabolism
bvg00380  Tryptophan metabolism
bvg00410  beta-Alanine metabolism
bvg00561  Glycerolipid metabolism
bvg00620  Pyruvate metabolism
bvg00903  Limonene and pinene degradation
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104897405
   00053 Ascorbate and aldarate metabolism
    104897405
   00620 Pyruvate metabolism
    104897405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104897405
   00561 Glycerolipid metabolism
    104897405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104897405
   00310 Lysine degradation
    104897405
   00330 Arginine and proline metabolism
    104897405
   00340 Histidine metabolism
    104897405
   00380 Tryptophan metabolism
    104897405
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104897405
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104897405
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104897405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104897405
NCBI-ProteinID: XP_010682575
LinkDB All DBs
Position
6
AA seq 534 aa AA seqDB search
MASRRISSLLSRSLSTYLSSPAGRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLING
QFVDAASGKTFHTVDPRTGNVIADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRI
LLRGADLIEKHNDVIAALETWDNGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPAD
GPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNSVVLKSAEQTPLSALYVANL
LHEAGLPPGVLNVISGFGPTAGAALCSHMNVDKLAFTGSTSTGKLVLELAAKSNLKPVTL
ELGGKSPFIICEDADIDEAVETAHFALFFNQGQCCCAGSRTFVHENVYDEFVEKAKLRAA
NRSVGDPFKQGIEQGPQIDPEQFNKILRYIKSGVESGATLETGGDKIGSKGYYIKPTVFS
NVTDDMLIAQDEIFGPVQSILKFKSIDEVIRRANASDYGLAAGVFTKNIDTANTISRALK
AGTVWINCYDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAIVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtcggagaatttcatctctgttatctcgttcattgtccacttatcttagctct
cctgctgggaggagctcatgtgtaaggaggggacttcaaagatacagcactgctgctgcc
attgatgaaccaattaccccaccagtggaagtaaattatacaaagcttctaattaatggc
caatttgtagacgcagcatcagggaaaacttttcacacagtggaccctcggactgggaat
gtgattgctgatgttgctgaaggagatgccgaagatgtgaacagagcagtgtctgctgct
cgcaaggcattcgatgaaggaccatggccgaagatgactgcttatgaaaggtcaagaatc
ctgctgagaggtgctgatctaattgaaaagcataatgatgtgatagctgcactagaaaca
tgggataacgggaagccttatgagcaatctgcgaaagttgaaataccaatgcttgttcga
cttttccggtactatgctggttgggctgataagatacatggtctcacttgtcctgctgat
ggaccatatcatgtgcagaccctgcacgaaccgattggtgtagcagggcagatcattccg
tggaactttcccctccttatgtttgcctggaaggtcggacctgccttagcatgtggtaat
tcagttgttctaaagtcagcagaacagactcctttatctgcactttatgtggctaatcta
cttcatgaggctggactccctccaggtgttctgaatgtgatttctggttttggcccaact
gctggtgcagctctctgctctcacatgaatgttgacaagcttgcttttactggatcaact
agcactggaaaactagttcttgaattagcagcaaaaagcaatctgaagcctgttactttg
gagcttggtgggaagtctccatttatcatatgtgaagatgcagatatagatgaagcagtg
gagactgctcattttgctctctttttcaatcagggacaatgttgctgtgctgggtcacgt
accttcgtccatgaaaatgtatatgatgaatttgttgagaaagcaaagctgcgagcagca
aatagatctgtcggtgatccatttaagcaggggatcgaacaaggtccacagattgatccg
gagcagttcaataagattttgcggtatataaaatctggtgttgaaagtggagctaccctg
gaaactggaggggacaaaataggctccaagggctactacattaagcccacagttttctca
aatgttacggatgacatgttgatagcacaagatgaaatcttcggtcccgtgcaatctatc
ttgaaattcaagagcatagatgaggtgatacgtcgagcaaatgcatctgattatgggctg
gccgctggagttttcactaagaacatcgatactgctaacactatatcacgcgctcttaaa
gctggtacggtgtggataaactgttacgatgtttttgatgctgcaatccctttcggcggg
tacaaaatgagtgggattggtagagagaagggagtttacagcttaaataactacttgcaa
gtgaaggccattgtcactcccttgaagaatccagcctggttgtag

DBGET integrated database retrieval system