KEGG   Beta vulgaris (sugar beet): 104897877
Entry
104897877         CDS       T03548                                 

Definition
(RefSeq) cytochrome P450 704B1
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00071  Fatty acid degradation
bvg00073  Cutin, suberine and wax biosynthesis
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104897877
   00073 Cutin, suberine and wax biosynthesis
    104897877
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bvg00199]
    104897877
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     104897877
Cytochrome P450 [BR:bvg00199]
 Cytochrome P450, plant type
  CYP704 family
   104897877
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 104897877
NCBI-ProteinID: XP_010683141
LinkDB
Position
6
AA seq 539 aa
MMIKTDNSKPIISSFSSSYSTGSILLVACCMGFSWLFIHRLSQRNKLGPKTWPLIGAALE
QFMNYDNMHDWLVEYLSKCRTVVVPMPFTTYTYIADPSNVEHVLKTNFVNYPKGEVYQSY
MEVLLGDGIFNADGESWRKQRKTASFEFASKNLRDFSTVVFREYSLKLFTILSEASFENR
SVDMQELLMRMTLDSICKVGFGVEIGTLAPDLPENSFARAFDTANIIVTLRFIDPLWKIK
KFLNVGSEALLSESIKIIDDFTYSVIRRRKSEIEEAKRDSNAIKMKHDILSRFIELGEDP
ESNTTEKSLRDIVLNFVIAGRDTTATTLSWAIYMIMSHQSVAEKLYQELKALEEERAIEE
NVELIECDIDDTVSFNKRVSQFAQLLTYDSLAKLYYLHAVVTETLRLYPAVPQDPKGILE
DDVLPDGTKVKAGGMVTYVPYSMGRMEYNWGPDAADFKPERWLKDGFFQNASPFKFTAFQ
AGPRICLGKDSAYLQMKMALAILCRFYTFKLVAGHPIKYRMMTILSMAHGLKLTVSRCS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgatgatcaaaacagataattctaagcccataatttcttctttttcatcatcttatagc
actggatccatacttttggtagcttgttgcatgggattttcatggcttttcattcataga
ttgagccaaaggaacaagttggggcctaagacatggcctttgattggggcagctcttgaa
caatttatgaattatgataacatgcatgattggcttgtcgaatatctctccaaatgtaga
actgttgtggtccctatgcccttcactacatacacctatattgctgatccttctaacgtg
gagcatgttcttaagaccaattttgttaattatccaaagggtgaagtctaccagtcgtac
atggaagttctgctaggagatgggatttttaatgcagatggtgaaagttggagaaaacaa
agaaaaactgcaagctttgagtttgcatcaaagaacttaagagacttcagcactgttgtt
tttagagagtatagcttgaagctttttactattttgagtgaggcgtcttttgagaatcgg
tcggtcgacatgcaggaattgttgatgaggatgacattggattccatatgcaaggtgggt
tttggtgtagagattggaactttggcacctgacctacctgagaactctttcgctcgtgct
tttgacacagctaacatcattgtcacactaagatttattgatcctctttggaagatcaaa
aaatttctaaacgtgggatcggaggctttacttagcgaaagtattaaaataattgatgat
tttacttattctgttatccgaagacgcaaatctgaaattgaagaagctaaaagagattcc
aacgccatcaagatgaaacatgacatattgtcaaggtttatagagcttggagaagatcca
gagagcaacacaacagagaagagcctaagagatatagtgctaaattttgtgatcgccggt
cgcgacaccacagcaacaacactgtcatgggcaatatacatgataatgagccatcaaagt
gttgctgaaaagctttatcaagaattaaaagcccttgaagaagagagagcaattgaagag
aatgtggagttgattgaatgtgatatagatgacactgtatcttttaacaaaagggtgtca
caatttgctcaacttttgacgtatgactccttggctaagttgtattatttgcatgctgtt
gttaccgaaactcttagactctatcctgcagttcctcaggacccaaaaggtatattggag
gatgatgtactaccagatggaacaaaagtaaaagcaggtggtatggtgacttatgttcca
tattccatgggtagaatggagtacaattggggacctgatgctgctgatttcaagcctgag
agatggcttaaagatgggttctttcagaatgcctccccttttaaattcactgcttttcag
gctggaccaaggatatgcctcggaaaggattcagcttatctacagatgaagatggcatta
gctattctgtgtagattttatacattcaagttggtcgcagggcaccctatcaagtatagg
atgatgacaattctgtcaatggctcatggattaaagcttacagtctctaggtgctcttaa

DBGET integrated database retrieval system