KEGG   Beta vulgaris (sugar beet): 104902309Help
Entry
104902309         CDS       T03548                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00010  Glycolysis / Gluconeogenesis
bvg00051  Fructose and mannose metabolism
bvg00052  Galactose metabolism
bvg00500  Starch and sucrose metabolism
bvg00520  Amino sugar and nucleotide sugar metabolism
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
bvg01200  Carbon metabolism
Module
bvg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104902309
   00051 Fructose and mannose metabolism
    104902309
   00052 Galactose metabolism
    104902309
   00500 Starch and sucrose metabolism
    104902309
   00520 Amino sugar and nucleotide sugar metabolism
    104902309
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104902309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bvg04131]
    104902309
Enzymes [BR:bvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104902309
Membrane trafficking [BR:bvg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104902309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 HMG-CoA_red
Motif
Other DBs
NCBI-GeneID: 104902309
NCBI-ProteinID: XP_010688341
LinkDB All DBs
Position
8
AA seq 498 aa AA seqDB search
MRKAAVGATVICAAAVCAAAAVVVRQRMKSSSKWARAMAILKELDEKCETPLGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKG
VVQQEFDEVSIPPELMVGTSEELFDYIAAALAKFVATEGEGLHPEPNRQRELGFTFSFPV
KQTSIASGTLIRWTKGFSIEDTVGEDVVAELTKAMKRKGVDMRVTALVNDTVGTLAGGRY
TKGNVIAAVILGTGTNAAYVERASAIPKWHGPLPRSGEMVINMEWGNFRSSHLPLTEYDI
ALDEESLNPGEQIYEKMISGMYLGEIVRRVLCKMAEEASFFGDTVPPKLKTPFILRTPDM
SAMHHDTSPDLKVVASKLKDVLGIPNTSLKVRKVIVDICDIIASRGACLSAAGILGIIKK
LGKDALKQGENQKSVIALDGGLFEHYAKFRECMEDSLKELLGDEIADTIVVEHSNDGSGI
GAALLAASHSQYLEEEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcagcggtgggtgcgacggttatatgtgcggcggcggtgtgtgcggcggcg
gcagtggtggtgcgtcaaaggatgaaaagttcaagtaagtgggctcgtgcaatggctata
cttaaggagcttgatgaaaagtgtgagacacctttgggtaaattaagacaagtggcagat
gctatgacagttgagatgcatgctggacttgcatcagagggtggttctaagcttaagatg
ttaatcagctatgttgataatcttcctactggggatgaacatggattgttctatgcatta
gaccttggtggcaccaactttcgagtactacgagtgaaattgggtggcaaagaaaaaggt
gttgttcaacaagaatttgacgaagtgtcaattccacccgagttgatggttgggacgtca
gaagaactgtttgattacatagctgctgcacttgctaaatttgttgcaacggaaggtgaa
ggtcttcatcctgaaccaaatagacagagagagctgggatttaccttctctttcccagtt
aaacagacatcaattgcatcagggactcttataaggtggaccaaaggcttcagcatagaa
gatacagttggtgaagacgtggtggccgaattgaccaaggccatgaaaagaaagggtgta
gatatgcgtgtgacagctttggtcaatgatacagttggaaccttagctggaggtaggtat
actaaaggaaatgtaattgctgctgtcatattgggtactggaacaaatgcagcttatgta
gaacgtgctagtgcaattcctaagtggcatggtcctttgcccagatcaggggagatggtt
attaacatggagtggggcaatttccgttcatcgcacttgcccttgacagaatatgatatt
gcactagatgaagaaagtttgaatcctggtgaacagatctatgagaaaatgatatctgga
atgtacttgggggagattgtgcgtagagtcttgtgtaagatggcagaagaggccagtttc
tttggtgatacagtcccaccaaaactgaaaactccattcatcttaaggacaccagacatg
tctgccatgcatcatgacacatcacctgatcttaaagttgtcgctagcaaactgaaggat
gtcttagggataccaaatacatcattgaaagtgagaaaggttatagttgacatatgtgac
attatcgcttctcgtggggcctgcctttctgcagccgggatcttgggcattattaagaaa
ctagggaaagacgcattgaagcaaggtgagaatcagaagtctgtgattgcattagatgga
gggttgtttgaacactacgccaagttccgagagtgcatggaggactctttgaaggaatta
ctaggtgatgaaatcgctgacaccatcgtagtcgagcactcaaatgatggatcaggcatc
ggggctgctctcctagcagcatcgcattctcagtatcttgaggaagaagaatcttga

DBGET integrated database retrieval system