KEGG   Beta vulgaris (sugar beet): 104902910Help
Entry
104902910         CDS       T03548                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg03030  DNA replication
bvg03410  Base excision repair
bvg03420  Nucleotide excision repair
bvg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104902910
   03410 Base excision repair
    104902910
   03420 Nucleotide excision repair
    104902910
   03430 Mismatch repair
    104902910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bvg03032]
    104902910
   03400 DNA repair and recombination proteins [BR:bvg03400]
    104902910
Enzymes [BR:bvg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104902910
    6.5.1.6  DNA ligase (ATP or NAD+)
     104902910
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104902910
DNA replication proteins [BR:bvg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104902910
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104902910
DNA repair and recombination proteins [BR:bvg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104902910
   NER (nucleotide excision repair)
    Other NER factors
     104902910
   MMR (mismatch excision repair)
    Other MMR factors
     104902910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase CBX7_C
Motif
Other DBs
NCBI-GeneID: 104902910
NCBI-ProteinID: XP_010689152
LinkDB All DBs
Position
9
AA seq 887 aa AA seqDB search
MLKISSSCFLSLRPLNATTTTSVSLFKLKPLSFSLLSHKFHFSAILKLRAMSSPPSAFDA
LMSGARKAAASKKKSENNNNTPSSSSPRKRKKTLDQSPPISENPNSVPLESNSKVELATQ
NNELQNPAVKKSKSDGGNVGDFVANSKKKPADLENPNSTPQESSSIVEPAIEKNELQNPA
VKKAKSDGANVGEFVANSKKKPADSENLNSTPQGSNSIVKPATQKNELRNPFAKKAKVSI
NVDEFVANLKKKPANFDPNLAAWWEGGEKVPFLFLAKAFDLIKGESGRIVITDITCNLLR
TVIAKTPEDLLEVVYLLANKIAPGHQGLELGIGDASLIKALAEACGATETVVKKLYKDLG
DLGDVAKEIRSKQSMMRQPPPLTINKVFSTFLLIAQASGKDSQERKKNYIKSLLVAAKDC
EPVYLMRLLQAKLRISLAEKTLLVALGQAAVYSEEHSKPPSNIQSPLEEAGKIVKQVYSV
IPVYDKIIPALLSDGVWNLSKTCNFAPGIPIGPMLAKPTNGVSEIIDKFQDMLFTCEYKY
DGERAQIHFMEDGSVEIYSRNAERNTGKYPDVVAALPRFKKPSVHSFVLDCEIVAYDREK
QKILPFQILSTRARKNVAISDIKVEVCVFAFDLLYLNGEALLQEQLNVRRKHLYDSFEEE
PGFFQLATTLESNDLEEIQKFLDAAVNASCEGLIIKTLEKEATYEPSKRSNNWLKLKKDY
MDSVGDSLDLVPIGAFHGRGKRTGVYGAFLLACYDSNNEEFQTICKIGTGFSEVVLEERS
SSLRSQVIPNPKSYYRYGDTLKPDVWFEPSEVWEVKAADLTISPVHRAAVGEVDSDKGIS
LRFPRLLRIREDKAPEDATSSDQVAEMYRSQANNPHRKSKNDLEEED
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaatttcttcttcttgctttctcagtcttcgtccactcaacgccaccaccacc
acttcagtttctctcttcaaactcaaacccctctctttctctctcctctcacacaaattc
catttttctgcaatcttgaagcttcgagctatgtcttctcccccctccgctttcgacgct
ctcatgtccggcgcgcgcaaagctgctgcttctaagaagaaatcggaaaacaacaacaat
actccttcttcttcttccccaagaaaacgaaaaaaaaccctagaccaatctccccccatt
tcagaaaaccctaattccgtacccctagaatccaattcgaaagtagaactagctacccaa
aacaacgaattgcaaaatccagctgttaaaaaatctaaaagtgatggtggtaatgtgggt
gattttgttgccaattcgaagaaaaagccagcggatttggaaaaccctaattccacaccc
caagaatccagttcgatagtggaaccagctatcgaaaaaaacgaattgcaaaacccagct
gtcaaaaaagctaaaagtgatggtgctaatgtgggtgaatttgttgccaattcgaagaaa
aaaccggcggattcggaaaacctcaattccacaccccaaggatccaattcgatagtgaaa
ccagctacccaaaaaaatgaattgcgaaacccttttgccaagaaagctaaagtcagtatt
aatgtggatgaatttgttgctaatttgaagaagaagccggcgaatttcgacccgaatttg
gcggcttggtgggagggtggtgagaaagttccatttctttttcttgccaaagcatttgat
ttaatcaaaggcgagtctggtaggattgtgatcactgatattacttgtaatctgttgagg
actgtgattgcaaagactcctgaagatcttttggaggttgtttatcttttggccaacaag
attgctcctggacatcaaggtttggaacttggaatcggagatgcttcgcttatcaaggcg
cttgcggaggcgtgtggagctactgaaactgttgttaagaagttgtataaggatttaggt
gacttgggggatgtcgccaaagaaatccgttctaagcagagtatgatgcggcaacctcct
ccactgaccatcaataaagtttttagtactttcctgctcatcgctcaggcatctggaaaa
gatagtcaagaaaggaaaaagaactatatcaagtcactccttgtggctgccaaagattgt
gaacctgtatatttgatgcggctgcttcaggcaaaattgcggattagtttggcagagaaa
actcttcttgttgccctggggcaagctgctgtatactccgaagagcactcaaagcccccg
tcaaatattcaatctccactagaagaggctggaaagattgtcaagcaagtatactccgtg
attcctgtgtatgataaaataatccctgcccttctcagtgatggtgtatggaatctatca
aagacctgtaactttgcaccaggtattcctataggacctatgctagcaaagccaacaaat
ggagtttcggagattattgataaatttcaagatatgttatttacttgtgagtacaagtat
gatggggaacgtgctcaaattcatttcatggaggatggctctgttgagatatacagccga
aatgctgaacggaacacggggaagtatcctgatgttgtagctgcacttcccaggttcaag
aagccatctgtacattcttttgttttggactgtgaaattgttgcttatgatcgtgagaag
cagaagattcttccgtttcagatacttagcacccgagctcgcaaaaatgttgcaataagc
gacataaaagttgaagtttgtgttttcgctttcgacttattgtatttgaacggtgaagca
cttctccaggagcagcttaatgttcgcagaaagcatctctatgattcttttgaggaagaa
cctggtttttttcagctggctacaacgctcgagtctaatgatcttgaggagatacaaaag
tttcttgatgctgctgttaatgccagttgtgaggggttgatcatcaaaacattggaaaag
gaggccacctatgagccttcaaagcgctctaacaactggcttaaattgaaaaaggattac
atggacagtgttggggactctctagatctggtgcctattggagcattccatggtcgtggg
aaacgaacaggtgtttatggtgcttttctccttgcttgttatgacagtaacaatgaagag
ttccagaccatatgcaaaatcggtactggtttctctgaggtggtgcttgaagaacgttct
tccagtcttcgttctcaagtgattcccaatccgaagtcatactatcgatatggagatacc
cttaaaccagatgtctggtttgagccctctgaggtgtgggaggtcaaagcagctgacttg
actattagtcctgttcaccgagctgcagttggtgaagtagattctgacaagggaatttca
cttcgatttccacgtttgcttcgtattagagaggacaaagctccagaggatgccacatca
tctgatcaggtggcagaaatgtaccgttctcaagcaaacaatccgcaccgtaaaagtaaa
aatgatttggaagaagaggactga

DBGET integrated database retrieval system