KEGG   Beta vulgaris (sugar beet): 104902979Help
Entry
104902979         CDS       T03548                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104902979
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104902979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104902979
NCBI-ProteinID: XP_010689245
UniProt: A0A0J8BQL4
LinkDB All DBs
Position
9
AA seq 228 aa AA seqDB search
MQAALAAMTAHTILASHPTLSLVSPFSSPTTSTISTSLNSSTSSFNGLSFKLSSQIQSLS
VSSSVAPKPLTIVAASKKAVAVLKGTSNVEGVVTLTQEDDGPTTVNVRITGLTPGKHGFH
LHEFGDTTNGCISTGPHFNPSSMTHGAPEDEIRHAGDLGNIVANTDGVAEATIIDNQIPL
SGANSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcattggcagccatgacagcgcacaccattctcgcttcccaccctacatta
tctcttgtctctcctttttcctcacccactacaagtacaatctcaacttctcttaactcc
tctacctcttccttcaatggcctctctttcaagctttcctctcaaatacaatctctctct
gtgtctagttctgtggcccctaaacccctcaccattgttgccgcctccaaaaaagctgtt
gctgttcttaagggcacttccaatgttgagggtgtcgtcactttaacccaagaagatgat
ggaccaactacagtcaacgttcgtattactggacttactcctgggaaacatggatttcac
ttgcatgaatttggagatacaacaaatgggtgtatttctacagggccacattttaatcct
agtagcatgacacatggtgctccggaggatgaaatccggcatgcgggtgacctgggaaac
attgttgctaacacagatggagtggctgaggctaccatcattgataatcagattccgttg
agtggagcaaattctgttgttggtagagcccttgtggtccatgaacttgaagatgacctt
ggcaagggtggacatgaactgagtctgactactgggaatgctggtggcagattggcttgt
ggtgttgttggtttaactcctctgtga

DBGET integrated database retrieval system