KEGG   Beta vulgaris (sugar beet): 104903865Help
Entry
104903865         CDS       T03548                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00500  Starch and sucrose metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104903865
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     104903865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 104903865
NCBI-ProteinID: XP_010690292
LinkDB All DBs
Position
9
AA seq 430 aa AA seqDB search
MKIHNINFATLCCLSLSYFLLFSFVTPTLLFQGFNWESSNKPGGLYNSLKNSIDDLARAG
VTHVWLPPPTHSVSPQGYMPGRLYDLDSSRYGNEADLKSLINAFHQKGIKCVADIVINHR
CADKKDGRGIYCIFEGGTPDDRLDWGPWAICRDDTQYSDGSGNLDTGAGYGAAPDIDHLN
PRVQKELVDWMNWLKTEIGFDGWRFDFVKGYAPSITKIYMEKTRPDFAVGELWDSITYDP
DGKPDYNQDGPRNELAGWVQAAGGGVIAAFDFTTKGVLQAAVQGEWWRMKDSNGRPSGLI
GIMPKNAVTFIDNHDTGSTQRLWPFPADKVMQGYAYILTHPGIPSIFYDHFLEWGLKEEI
DKLTSIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYDLGNLIPSNFKASTFG
KDYCVWEKQG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaacataaattttgccactctttgttgcctctctctctcatattttctt
ctctttagctttgtaactccaaccttattgtttcagggtttcaattgggaatcttccaat
aaaccaggaggattgtataattccctcaaaaactcaatcgatgatttggctcgagcaggg
gttacacatgtttggcttcctccaccaactcactcagtttctcctcaagggtatatgcca
ggaagattatatgatcttgattcatctagatacgggaatgaggctgatctgaagagcttg
attaatgccttccaccaaaaaggaatcaaatgtgttgctgatatagttataaatcataga
tgcgcagataagaaagatggaagaggaatatactgtattttcgaaggcggaactccagat
gaccgcctagattggggaccttgggctatttgtagggacgacacacaatactctgatggt
agtggaaatctagacactggagctggttatggtgctgcacctgatatagaccatcttaat
ccaagagtacaaaaggagttagtcgattggatgaattggctcaagacagaaattggtttt
gacggatggagatttgattttgttaagggatatgctcctagcattaccaaaatttacatg
gaaaaaactaggcctgattttgcagttggagagctttgggattccattacatatgacccg
gatggtaagccagactataaccaagacggacctcgaaatgaactagctggatgggtacaa
gctgcaggtggtggtgttattgctgcatttgatttcactaccaaaggtgttcttcaagct
gctgttcaaggagaatggtggagaatgaaagattctaatggtaggcctagtgggttgata
ggaattatgcctaaaaatgctgtcacttttattgataatcatgacactggttccacacaa
aggttatggccttttcccgcagacaaagtcatgcaaggatatgcttatattctcacacac
ccaggaattccatcaatattctatgaccattttcttgaatggggactcaaggaagagatc
gacaaattgacttcgattaggctaagaaatgggataagtgaatcaagcaatgtgaatata
atggcctctgatgcagatttatatgtggcaatgattgatggaaaagttattgttaagctt
ggaccaagatatgatctaggaaatcttattccttccaatttcaaagcttctacttttgga
aaagattattgtgtttgggagaagcaaggttaa

DBGET integrated database retrieval system