KEGG   Beta vulgaris (sugar beet): 104904013Help
Entry
104904013         CDS       T03548                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00250  Alanine, aspartate and glutamate metabolism
bvg00410  beta-Alanine metabolism
bvg00430  Taurine and hypotaurine metabolism
bvg00650  Butanoate metabolism
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Module
bvg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104904013
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104904013
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104904013
   00430 Taurine and hypotaurine metabolism
    104904013
Enzymes [BR:bvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104904013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104904013
NCBI-ProteinID: XP_010690484
LinkDB All DBs
Position
9
AA seq 499 aa AA seqDB search
MVLSSAVTESDNSVHSTFASRYVRVCLPRFQMPDKSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDAINKNYVDMDEYPVTTELQNRCVNMIANLFNAPLGDSEVAVG
VGTVGSSEAIMLAGLAFKRRWQNKRKALGLPTDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVAKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCQENAMILKQGIEK
TDRFNIISKDMGVPLVAFSLKDNSLHNEFEISEHLRKFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLADRLVNDLQKVLNELDALPARANAKLNVPHAVDGENQASRKKTALEMQMEV
CNVWKKFVDDRKLKTNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttctctcaagtgctgtaactgaatctgataattccgttcactctacttttgcttcc
agatatgttcgcgtttgtcttcctaggtttcaaatgccagataaatcgataccaaaagaa
gcagcgtatcaaattataaatgatgagttaatgttggatggaaatccgaggttgaatttg
gcgtcatttgtgacaacatggatggagccagagtgcgataaattaatgatggatgccatt
aacaagaattatgttgacatggatgagtatcctgttaccactgagcttcagaatagatgc
gtgaacatgattgccaacttgtttaatgcaccacttggagactcagaagttgctgttgga
gtaggaacagtggggtcctcagaggccatcatgcttgctggtctggcattcaaaagaagg
tggcaaaacaaaaggaaggccctgggcttacccactgataagcccaacattgtcactggt
gccaatgttcaagtttgttgggagaaatttgcaagatacttcgaggtggagctaaaggaa
gttaagctgagtgatggatactatgtcatggaccctgaaaaggcagtggaaatggttgat
gagaacaccatctgtgttgctgctatccttggatccactctcaacggagaatttgaagat
gttaagctcttgaacgacctcctcgtggccaagaacaaagaaactggatgggatactcca
attcatgtggatgcagcaagtggtggtttcatagcaccatttatttacccagagttggag
tgggactttcggttgccattggtgaagagcatcaatgtcagtggtcacaagtacggactt
gtttatgctggtgttggttgggtcatctggaggagcaaggaggacttgcctgaagaactc
atcttccacatcaactatcttggtgctgatcaacctactttcaccctcaacttttccaaa
ggatccagtcaaattattgctcagtactatcagctaattcgcttgggatttgagggatac
aagaacatcatggagaactgccaagagaatgccatgatcttgaaacaaggaatagaaaag
actgaccgcttcaacatcatatccaaggacatgggggttccattagtggcattctccctg
aaagacaacagcctccacaacgaatttgagatctccgagcatcttcgtaagtttggttgg
attgtaccagcttacaccatgcccccagacgctcaacatgtgactgtgttgcgtgttgtc
atccgagaggacttctctcgcaccctggcagaccggttggtgaatgacctccagaaggtt
ctcaacgagcttgacgcccttcctgctcgtgccaatgccaagttgaatgttccacacgct
gtggatggtgaaaatcaagcttctaggaagaagactgccttggagatgcaaatggaggtc
tgcaatgtttggaagaaatttgttgatgataggaagttgaagaccaatggtgtttgctaa

DBGET integrated database retrieval system