KEGG   Beta vulgaris (sugar beet): 104904048Help
Entry
104904048         CDS       T03548                                 

Definition
(RefSeq) probable nitronate monooxygenase
Organism
bvg  Beta vulgaris (sugar beet)
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH Dus ThiG DHO_dh DHDPS CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 104904048
NCBI-ProteinID: XP_010690523
LinkDB All DBs
Position
9
AA seq 329 aa AA seqDB search
MGWKGILGFEYGIVQAPLGPDISGPELVAAVANAGAIALLRAPDWECPEYVREMIKKTRS
LTDKPFGVGVVIAFPQEENLKAIIEEKVAVLQLYWGEVSEELVRRAHDAGVKVVPQVGNI
EAARRAINVGVDAIIVQGREAGGHVIGQEGLVALVPRVVDLVGERDIPVIAAGGIVDARG
CVAALALGARGVALGTRFLATEESYAHPVYKRKLIEYSETEYTNVFGRARWPGAPQRVLL
TPFFSDWRSLPENEDEKNQPVIGRSIIHGVEKEVKRFAGTVPNKSATGDIECMAMYAGQG
VGLIKDILPAGEVVKKIVKEAQLLIQQKF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggggtggaagggaattctgggttttgagtatggaatcgttcaggccccactgggcccc
gacatttctggtcccgagcttgttgctgctgttgctaatgctggtgccattgcccttctt
cgagcccctgattgggaatgccctgaatatgtgagggagatgataaagaagactcggagc
ttaactgacaaaccttttggtgtcggcgttgttatagcatttcctcaagaggaaaatctg
aaagctataatagaggagaaagttgcagtactgcaactgtattggggtgaagtatcagag
gagcttgttcgcagagctcatgatgctggtgtcaaagttgttccccaagttgggaatatt
gaagcagcaagaagggccatcaatgttggagtagatgcaatcattgtacaaggtcgtgaa
gcaggtggacatgtaataggtcaggaaggattagttgctttggtgcctcgagtagttgat
ctagttggggaacgagatatcccagttattgctgcaggtggcattgtggatgcacgtggc
tgtgtcgctgctttggcccttggggcacgaggtgttgcccttggcactaggtttctcgcg
actgaagaaagctatgctcatcctgtgtacaagaggaagttgattgaatattctgaaact
gagtacactaatgtatttggtcgtgcaagatggcctggagcaccccagcgtgtcttacta
acaccgttctttagtgactggagatctcttcctgagaatgaagatgagaaaaaccagcct
gtcattggacgctcaataatacatggagtggaaaaagaggtaaaacgtttcgcaggaact
gtgcccaataaatcggcgacaggtgatatcgagtgtatggcaatgtatgcggggcaaggt
gttggcctcatcaaagacatcctacctgctggagaagttgtgaagaagattgttaaagaa
gctcaattgttgatacaacaaaagttctag

DBGET integrated database retrieval system