KEGG   Beta vulgaris (sugar beet): 104906496Help
Entry
104906496         CDS       T03548                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg03030  DNA replication
bvg03410  Base excision repair
bvg03420  Nucleotide excision repair
bvg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104906496
   03410 Base excision repair
    104906496
   03420 Nucleotide excision repair
    104906496
   03430 Mismatch repair
    104906496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bvg03032]
    104906496
   03400 DNA repair and recombination proteins [BR:bvg03400]
    104906496
Enzymes [BR:bvg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104906496
    6.5.1.6  DNA ligase (ATP or NAD+)
     104906496
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104906496
DNA replication proteins [BR:bvg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104906496
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104906496
DNA repair and recombination proteins [BR:bvg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104906496
   NER (nucleotide excision repair)
    Other NER factors
     104906496
   MMR (mismatch excision repair)
    Other MMR factors
     104906496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL Med15_fungi
Motif
Other DBs
NCBI-GeneID: 104906496
NCBI-ProteinID: XP_010693565
LinkDB All DBs
Position
2
AA seq 1376 aa AA seqDB search
MSTTKTLTLKTTELYLQPQNIHSHSLSPIPSNFPLSKLIPKTRFIIDGFRNSGEHSLSYF
LSHFHADHYSGLTSTWNRGIIFCSEITARLVVKVLEVSELFVFRLPMNETVVIDDCEVTL
IDANHCPGAVQFLFKVPVIGGKFERFVHTGDFRYCSDMSLTPVLSEFVGCDAVFLDTTYC
DPKFVFPLQEESVDYVVSVIDRIGSENRNVRKSVLFLVATYVIGKEKILLEISRRCGCKI
YVDSRKMEVLRALGYEDEGVFTEDESASDVHVVGWNVLGETWPFFRPNFVKMKEIMVEKA
YSKVVGFVPTGWTYEVKKNKFAVKTKEAFEIHLVPYSEHSNYNELREYVKFLKPKRVIPT
VGSDVENVDSKHAIKMQKHFAGLVDEMANKQEFLTSFYHVPQGREKVEVGDLVIELDKDV
KHLQEEFDVCDMKEDHQTGSSSMGKTIHEPGSQDLTSLTNTEKDEILQELRDCLPIWVSV
DQIVELIKIYGRNVVDAVSHFYEHETEFHEQSGKSLPSSQSNSKSPNFSLDETSLETLVE
SPKQNLKFPLLKQSVASSVSPRKRKRNSENKNNKKGKVKSNPEPGGIKQSTITKFFSKSS
SVCQGSIAVPLSGKSSEDQSLSSVLSVKQYEEELEQFIQIINGSESMKGYTAELIEKARG
NVDLALDMYYSKSEVNPGGKQKRLDASSKSLTCEDPDANLSSQGKESSEAMKKVYHEDLS
AENVAVSYVSLLPEKYSLVEHACWKQGQPAPYIHLARTFDLVEGEKGKIKATSMLSNMFR
SLLALSPEDVLPAVYLCTNKIAADHENMELNIGGSLVASALQEACGTNRAKIREMYNIFG
DLGDVAQECRQTQSLLLSPSPLLIRDVYSVLRKISIQTGTGSTSRRKSLIVSMMRSCREK
EMKFLVRTLVRNLRIGAMMRTVLPALAQAVALNYYDEKSVKNTKELLQDLSAAVVEAYNI
LPDLNLLVPSLISKGIEFSTTTLTMVPGIPIRPMLAKITNGVEQALKQFQNKAFTCEYKY
DGQRAQIHKLDDGSVRIFSRNGDETTSKFPDLVQVIQESCKPCAESFIIDAEVVGIDRKN
GHKFLSFQELSARERGGKATLISLDRIKVDVCVLAFDAMFVNGEKLLACPLRQRRQCMKD
IFRGEKQGFFEYAKEITVEADEARPDCEASLVKIDAFLKDAFLSSCEGIMVKSLDVDAGY
FASKRADSWLKVKRDYMDGVGDSLDLVPIGAWHGSGRKAGWYSPFLMACYNPDTEEFESL
CRVMTGFSDSFYKEMKEFFSEDKTLTKKPLYYRTDEVPDMWSTAEMVWEIKGADLTVSPV
HKAAFGIVHPSRGISMRFPRFIRSLLDRRPEDCSTSTDVAEMFHSQTRKMDVTGAH
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaccaaaaccctaaccctaaaaactaccgaactttatcttcaacctcaaaac
attcattctcactctctctcaccaattccttcaaacttccctctctccaaactcatccct
aaaactcgcttcatcatcgatggcttccgaaattccggcgaacattctctctcttacttc
ctctctcactttcacgccgatcactattccggcctcacttccacgtggaatcgcggcatc
attttctgctccgaaatcaccgctcgtctcgtcgtcaaggttctagaagtttctgaattg
tttgtttttcgtttgccgatgaatgagaccgttgtaatcgatgattgtgaggtaacctta
attgatgctaatcattgtcctggtgctgttcaatttttgtttaaagttcctgttattggt
ggtaaattcgaacgttttgttcatactggtgattttaggtattgtagtgatatgtcactg
acacctgttttgagtgaatttgttggttgtgatgctgtttttctcgatacgacttattgt
gacccgaaattcgtgtttccgttgcaagaggagtcggttgattatgtagttagtgtgata
gataggattggtagtgagaataggaatgtgaggaagagtgttttgtttcttgttgcaact
tacgttattggaaaagagaaaattttgttggaaatttcgcgtaggtgtgggtgtaagata
tatgtagatagcaggaaaatggaggttttgcgggcgttgggttatgaggatgagggcgtg
tttacagaggatgagtcggcgagtgatgttcatgttgttgggtggaatgtgttgggtgag
acttggccgttttttcggcctaattttgttaagatgaaggaaattatggttgagaaggcg
tattcaaaggttgtggggttcgttcctactggatggacatatgaagtgaagaaaaataag
tttgcagtcaagacgaaagaggcttttgaaattcatctggtgccgtatagtgagcattct
aactataatgagcttagagaatatgttaagtttttgaaaccaaagcgtgtaattcctaca
gtaggctctgatgttgaaaatgtggatagtaaacatgctattaagatgcaaaagcacttt
gcaggattggtggatgaaatggccaacaagcaagagtttttgacgagtttttatcatgta
ccccagggaagagaaaaagtcgaggtaggtgatctggtgattgagttggacaaggatgta
aaacatctccaagaggagtttgacgtgtgtgacatgaaggaagatcatcaaactggttcc
agttctatgggcaaaacaatacatgaacctggttcacaagatttaacctcgcttactaat
acggaaaaagatgaaatcctgcaagagcttcgcgattgtttgcccatttgggtttccgta
gatcagattgtagaactcatcaaaatttatggtagaaatgttgttgatgcagtttctcat
ttttacgaacatgaaacagaatttcatgagcaaagtggaaaatctctcccgtcatctcag
tcaaattcaaagagtccaaattttagtcttgatgagaccagtcttgagacgttggtggag
tcacctaagcaaaacctcaaatttccactgttgaagcagtcagttgcaagcagtgtttct
cctagaaaaaggaagagaaactcagagaataagaataataagaagggaaaagttaaatct
aatcctgaacctggtggcataaagcaatctacaataactaagttcttcagtaaaagtagc
agtgtttgtcagggaagtattgctgttcctttgtccgggaaaagctccgaagaccagagt
ttatcttctgtactttcagttaaacagtacgaggaagagttggaacaatttattcagatc
attaatggcagtgaatcaatgaaaggatatactgctgaactgatcgaaaaggcgagagga
aatgtcgacttggcactggacatgtattacagtaaatctgaagttaaccccggtggtaag
cagaaaaggctagatgctagtagcaaatcactaacatgtgaagatccagatgctaattta
tctagccaaggaaaagaaagttctgaagctatgaagaaggtttatcatgaagatttatcg
gcggaaaatgttgctgttagctatgtatcactactgccagagaagtattctcttgtagaa
catgcttgctggaagcaaggccagcctgctccgtatatacacttggcacggacttttgat
cttgttgaaggtgaaaaggggaaaattaaagctacatctatgctttccaatatgtttaga
agtttactggcgttgtctcctgaggatgttttacctgctgtttatctgtgcacgaacaag
attgccgctgaccatgaaaatatggaactaaacatcggtgggagtttggttgcatctgct
cttcaagaggcatgtggaaccaatagagctaagataagagaaatgtataacatctttggt
gatcttggtgatgttgctcaagagtgtcggcaaacacaatctttacttctttcgccttct
ccccttttgattcgagatgtatattctgtacttcgaaaaattagcatacagacgggcact
ggaagcacaagtaggaggaaaagcttaattgtcagtatgatgcgatcttgcagagagaag
gaaatgaagtttcttgtcaggactctggtgagaaacctacggattggagccatgatgagg
acagttcttcctgcattggctcaagcagttgctctgaactattatgacgaaaaatcagtt
aaaaatacaaaagaattgcttcaggacctttctgctgctgttgttgaagcttataatatt
cttccagacttgaatttattggtgccctctctgataagcaaaggcatagagttttccacc
actactttgactatggtaccaggcattcctatcaggcccatgcttgctaaaataactaac
ggagttgagcaagcactaaagcaatttcagaataaagctttcacatgtgaatacaagtat
gatggtcaacgcgcccaaattcacaaacttgatgatggttctgtgcgcatcttttcaaga
aatggggatgagacgacatcaaagtttccagatttggtgcaggttattcaggaatcatgt
aaaccttgtgcagagtctttcattatcgatgctgaggtggttggaattgatcgcaagaac
ggacacaagtttttatcttttcaagaattatctgcccgagagagaggtggcaaagctaca
ttgatttcattggacagaataaaggttgacgtctgtgtccttgcatttgatgccatgttc
gtcaatggagagaagctgttggcttgtccacttaggcaaagacggcagtgtatgaaagat
atttttagaggggaaaagcaggggttttttgagtatgcaaaggaaataactgttgaagca
gatgaagctcgtccagattgtgaagccagtttggtaaagatagatgctttccttaaagat
gcatttctttcctcttgtgaaggcatcatggttaaatcactagatgttgatgctggctac
tttgcttcaaagcgtgctgattcatggttgaaggtaaagcgggattatatggacggagtg
ggggattccctagatttagttcccattggtgcttggcatggcagtggaagaaaggcagga
tggtatagtccattccttatggcttgttacaatcctgataccgaggaatttgagagcttg
tgccgtgtaatgacaggtttttctgattctttttacaaagagatgaaagaatttttttct
gaagacaagaccttgaccaaaaagcccctatattaccgaacagatgaagttcctgatatg
tggtctacagctgaaatggtctgggaaataaaaggtgcagacctcactgtatcacctgtt
cacaaggctgcgttcggaattgttcatccttcacgaggaatatctatgagattcccgaga
tttatccgttcgctattggacagacgaccagaagactgcagtacctcaacagatgttgct
gaaatgtttcattctcagactcgaaaaatggatgtaactggtgctcattga

DBGET integrated database retrieval system