KEGG   Beta vulgaris (sugar beet): 104906822Help
Entry
104906822         CDS       T03548                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104906822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bvg03036]
    104906822
Enzymes [BR:bvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104906822
Chromosome and associated proteins [BR:bvg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104906822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 104906822
NCBI-ProteinID: XP_010693943
LinkDB All DBs
Position
3
AA seq 665 aa AA seqDB search
MGSIVPFPDLNLLPDTRISSSTPVPVPAAVIRRPKLEIRVKSEPIDDPISDIQTPDLIPS
SPPPNDPNFLALEPSPSTHEDSTNVYSEFYRISEMFRSAFANQMQQHQHPQQTPLDSDSG
AIVAVPDGDNHISALAVSAPSIRRQKRSNELVRVTNLSVEDQRYFRDIVRRTRMLYDALR
IYSMAEEERRIGPGAGRRARGDLRAATLMRDRGLWLNRDKRIVGSIPGVFIGDLFYFRME
LCVVGLHGQSQAGIDYLPSSQSSNGEPIATSIIVSGGYEDDEDAGDVLVYTGHGGLDKLH
RMCNHQKLEGGNLALERSMHYGIEIRVIRGLKYEGSLTTKIYVYDGLYRIVESWFDVGKS
GFGVYKFKLIRIEGQPEMGSTLLKLAHGLRTRPLQVRSAGYLSLDLSVKKEKTPIFVFND
IDSDKDPLYYDYLPRTVFPPFVYAGGNMGCNCVTSCHDGCLCGMKNGGEIAYDHNGFLLR
GKPLLFECGSHCTCPPNCRNRVSQKGLKNRLEVFRSRETGWGVRTLDLIHAGAFICEYAG
VVLTREQAQVFTMNGDSLIYPGRFTEKWAEWGDLSQIYPEYVRPTYPSIPPLDFAMDVSR
MRNVACYISHSTSPNVMVQFVLYDHNNILFPHLMLFAMENIPPMRELSLDYGVADEYTGK
LSICN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgggatctattgtcccatttccagacctgaatcttctccctgacacacgaatctcatct
tctacaccagtaccagtaccagcagcagttattcgtcgtcccaagctcgaaatccgggtg
aaatccgaacccattgacgaccccatttcagatatccaaacccctgatttaattcctagc
tccccacctcctaatgaccccaattttctcgctctcgaaccttctccttctacccacgaa
gattccaccaatgtttactctgaattttatcggatttcagagatgtttcgctctgcattt
gcaaaccaaatgcagcagcaccaacatccacagcagactcctctggactctgattccggt
gccattgttgctgtccctgatggggataaccatatttcagccctggccgtgtcggccccg
agtattcggcgccaaaagaggtctaatgagcttgttcgtgtcactaatcttagtgtggag
gatcagagatacttcagggatatagtgaggaggactcgaatgctttacgacgcgttgagg
atatattcgatggcggaggaagagaggaggattggtcctggagctgggaggcgagctcgt
ggcgatttaagagctgctacattgatgagggatcgtgggctatggcttaatagggataaa
aggattgttgggtcaattcctggtgtgtttattggtgacttgttctactttagaatggag
ctttgtgtggttggtttacatggccagtctcaagctggaattgattatttgccttccagt
cagagttctaatggcgaacctattgccaccagtattattgtttctggtggctatgaggat
gatgaagatgctggagatgtgcttgtttatacaggccatggtggtctcgataaacttcac
aggatgtgcaatcatcagaaacttgaaggaggtaatttggctttggaaagaagtatgcat
tatggtattgagattagagtcattaggggtcttaaatatgaaggtagtcttactactaag
atttatgtttatgatggtttatatagaattgttgagtcttggtttgatgttgggaaatct
ggttttggtgtctataagtttaagcttattagaattgagggtcaacctgaaatgggtagt
acccttttgaaacttgctcatggcttgagaactaggccactgcaagttcgatctgcgggc
tatcttagtctcgacctttccgtgaagaaggagaaaacccccatttttgtttttaatgat
attgattccgataaagaccccttgtactatgactatcttccaaggacggtgtttccgcct
ttcgtttatgcgggtgggaatatgggttgtaattgtgttaccagttgtcatgacgggtgt
ttgtgtgggatgaagaatggaggggagattgcttatgatcataacggctttttattgaga
gggaaacctttactattcgaatgtggcagccattgtacctgcccgcctaattgccggaat
cgtgtgagccagaaagggctgaagaatagattggaagtgtttaggtccagggaaacgggt
tggggagttcgaactttggacttgatacatgctggtgcttttatatgtgaatatgcgggg
gttgttcttacaagggagcaggctcaagttttcaccatgaatggagacagtcttatatat
cctggtcggtttacagaaaaatgggctgaatggggggatttgtcccaaatatatccagag
tatgtgaggccaacatatccctctattcctccattggattttgccatggatgtttccaga
atgagaaatgttgcttgttatataagtcatagtacgagtcccaatgtgatggtgcagttt
gtgctctatgatcataacaacatattgtttcctcatcttatgttgtttgcgatggagaat
atcccaccaatgcgagaacttagccttgattatggggtagctgatgaatacactggaaag
ctctcaatctgcaactag

DBGET integrated database retrieval system