KEGG   Beta vulgaris (sugar beet): 104907577Help
Entry
104907577         CDS       T03548                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00480  Glutathione metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104907577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvg02000]
    104907577
Enzymes [BR:bvg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104907577
Transporters [BR:bvg02000]
 Other Transporters
  Pores ion channels [TC:1]
   104907577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_6 GST_C_5
Motif
Other DBs
NCBI-GeneID: 104907577
NCBI-ProteinID: XP_010694823
LinkDB All DBs
Position
4
AA seq 218 aa AA seqDB search
MANEVVLLDFWPSPFGMRVRIALAEKEVKYEYRDENLRDKSELLLKMNPVHKKIPVLVHN
NKPVCESLIIVEYIDEVWSDKYPLLPSDPYQRAQARFWADFVEKKMYTTGRSVWSTKGAE
QEAAIRDFIDHLKLLEQELGNKPYFGGDNFGYVDLTFIPYYSWFHAYETLGNFKIEESCP
KIIEWAKRCMERETVAKALPDQKKVYEFVLELKKMYGL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaagtagtattgttggatttctggccaagcccgtttggaatgagggtgagg
atagcattagctgagaaagaagtgaagtacgagtatagagatgagaatttgagagacaaa
agtgagttacttctcaaaatgaacccggttcataaaaagattccggttctcgttcacaac
aacaaaccggtttgcgagtctcttatcattgttgagtatatagatgaggtctggagtgac
aagtaccccttgttaccttctgacccttatcaaagggctcaggctcgtttttgggctgat
tttgtcgagaaaaagatgtataccactgggaggagtgtttggagcacaaaaggagcagaa
caagaggcggcaattagagattttatagaccacttgaaactgttggagcaagagcttggc
aataaaccttattttggaggggataactttggctatgttgatcttacattcattccatac
tatagttggtttcacgcctatgagactttgggcaactttaagattgaagagtcgtgccca
aagattattgaatgggccaagaggtgcatggagagggaaactgtggccaaggctctccca
gatcagaagaaggtttatgaatttgttttggagttaaagaagatgtatggcctttag

DBGET integrated database retrieval system