KEGG   Burkholderia vietnamiensis G4: Bcep1808_0315Help
Entry
Bcep1808_0315     CDS       T00493                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bvi03012]
    Bcep1808_0315
   03029 Mitochondrial biogenesis [BR:bvi03029]
    Bcep1808_0315
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvi04147]
    Bcep1808_0315
Translation factors [BR:bvi03012]
 Eukaryotic Type
  Elongation factors
   Bcep1808_0315
 Prokaryotic Type
   Bcep1808_0315
Mitochondrial biogenesis [BR:bvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bcep1808_0315
Exosome [BR:bvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bcep1808_0315
  Exosomal proteins of breast cancer cells
   Bcep1808_0315
  Exosomal proteins of colorectal cancer cells
   Bcep1808_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29 AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABO53328
UniProt: A4JAM5
LinkDB All DBs
Position
1:355168..356358
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtcaacgttggtacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggtgctgacgaagaagttc
ggcggcgaagcgaaggcctacgaccagatcgacgcggcaccggaagagaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggcgaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgcgagcacatc
ctgctggcacgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggccaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgaacctggcagacgcactggacacg
tacatcccgacgccggagcgtgcggttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgcgtcgagcgcggcatcgtgaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccagggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgattgcgccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtaccgtcggcgctggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system