KEGG   Burkholderia vietnamiensis G4: Bcep1808_0889Help
Entry
Bcep1808_0889     CDS       T00493                                 

Definition
(GenBank) Smr protein/MutS2
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Smr Rep_N
Motif
Other DBs
NCBI-ProteinID: ABO53900
UniProt: A4JC97
LinkDB All DBs
Position
1:complement(968934..969713)
Genome map
AA seq 259 aa AA seqDB search
MAKNQPHPSDPAKRQIAARPVTPAPAAPPPALDAAALRGQGLAGLGALRKSLQGEAERRE
RTRVEAAKATRQAEADANLFRNEIGAIRPLNAPPRASAGRTPPDPVPKQTQRDEEAVLNA
TLSDEFDPETLLDSDESLYYHCPGISRDVVRKLRSGAWIVQAQLDLHGMRRDEARDALAE
FIREAGKKGLRCLRVIHGKGLGSIGKEPVLKGKVRAWLVQKEEVIAFCEARGHDGGAGAV
LVLLQPPASPADRGPRAAS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaccagccccacccgagcgatcccgcgaagcggcagatcgccgcccgcccc
gtgacccccgcgcccgccgcgccgccgcccgcgctcgacgccgccgccttgcgcggccag
ggcctcgccggcctcggcgccttgcgcaagtcgctgcaaggcgaagccgaacggcgcgaa
cgcacgcgcgtcgaagccgcgaaggccacgcgccaggcggaggccgacgcaaacctgttc
cgcaatgaaatcggcgcgatccggccgctgaacgcaccgccgcgcgcgagcgccggccgc
acgccgcccgacccggtgccgaagcagacgcagcgcgacgaggaagcggtgctgaacgcg
acgctgtcggacgaattcgatcccgaaacgctgctcgacagcgacgaatcgctgtactac
cactgccccggcatcagccgtgacgtggtgcgcaagctgcgcagcggcgcatggatcgtg
caggcgcagctcgacctgcacgggatgcggcgcgacgaggcgcgcgacgcgctcgcggaa
ttcatccgcgaagccggcaagaagggcttgcgctgcctgcgcgtgatccacggcaagggg
ctcggctcgatcggcaaggagccggtgctgaagggcaaggtgcgcgcgtggctcgtgcag
aaggaagaagtgatcgcgttctgcgaggcgcgcggccacgacggcggcgccggcgcggtg
ctcgtgctgctgcagccgcccgcgtcgccggccgatcgggggccgcgtgccgcatcctag

DBGET integrated database retrieval system