KEGG   Burkholderia vietnamiensis G4: Bcep1808_1043
Entry
Bcep1808_1043     CDS       T00493                                 

Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00998  Biosynthesis of various secondary metabolites - part 2
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcep1808_1043
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    Bcep1808_1043
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: ABO54054
UniProt: A4JCQ1
LinkDB
Position
1:1128459..1128698
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggataacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcggaa
gccgagatcaagaacgaagcatcgttcgtgaacgatctgggtgcagactcgctcgacacg
gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca
gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system