KEGG   Burkholderia vietnamiensis G4: Bcep1808_1618Help
Entry
Bcep1808_1618     CDS       T00493                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep1808_1618
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Bcep1808_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Plant_NMP1 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: ABO54625
UniProt: A4JEC2
LinkDB All DBs
Position
1:complement(1762127..1762831)
Genome map
AA seq 234 aa AA seqDB search
MPDLSAFPITKKWPARHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLSP
EFLSLNPNNKIPAIIDPNGPDGRPLALFESGAILLYLADKTGQLIPKDAAGRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGRDYDDKRPRDRYVAESKRLLGVLDAHLANRTWMMGDTYT
IADIAIFPWVRNLVGFYEAGDLVGFGEFRHVARALDAFVARPAVARGLNIPARD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatctgtccgccttcccgatcacgaaaaaatggccggcccggcacccggaccgc
ctccagctgtactcgctgcccacgccgaacggcgtcaaggtgtcgatcatgctcgaggaa
accggcctgccgtacgagccgcatctcgtgcgcttcgacacgaacgaccagttgtcgccc
gagttcctgtcgctgaacccgaacaacaagattccggcgatcatcgatccgaacggcccc
gacggccggccgctggcgctgttcgagtccggcgcgatcctgctctatctcgccgacaag
accggccagctgatcccgaaggacgcagcgggccgctacgagacgatccagtgggtgatg
ttccagatgggcggcatcgggccgatgttcggccaggtcggcttcttccacaaattcgcc
ggccgcgactacgacgacaagcgtccgcgcgaccgttacgtcgccgagtccaagcgcctg
ctcggcgtactcgacgcgcatctcgcgaaccgcacgtggatgatgggcgatacgtacacg
atcgccgacatcgcgatcttcccgtgggtgcggaacctggtcggtttctacgaggcgggc
gacctggtcggcttcggcgaattccgccacgtcgcgcgcgcgctcgacgcattcgtcgcg
cggccggccgtcgcgcgcgggctcaatatcccggcacgcgactga

DBGET integrated database retrieval system