KEGG   Burkholderia vietnamiensis G4: Bcep1808_1914Help
Entry
Bcep1808_1914     CDS       T00493                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00061  Fatty acid biosynthesis
bvi00780  Biotin metabolism
bvi01100  Metabolic pathways
bvi01212  Fatty acid metabolism
Module
bvi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcep1808_1914
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bcep1808_1914
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bvi01004]
    Bcep1808_1914
Enzymes [BR:bvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Bcep1808_1914
Lipid biosynthesis proteins [BR:bvi01004]
 Fatty acid synthase
  Component type
   Bcep1808_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABO54917
UniProt: A4JF64
LinkDB All DBs
Position
1:complement(2086266..2086733)
Genome map
AA seq 155 aa AA seqDB search
MSTEKINLDIHKILTLLPHRYPILLVDRVLELEPHKGIKALKNVSINEPFFQGHFPKRPV
MPGVLILEALAQAAALLTFAEEQPKDPENTLYYFVGIDGARFKRVVEPGDQLILNVTFER
YIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaaaatcaatctcgacatccacaagatcctcacgctgctgccgcatcgc
tacccgattctgctggtcgaccgcgtgctcgaactcgagccgcacaaggggatcaaagcg
ctgaagaacgtgtcgatcaacgagccgttctttcaggggcatttcccgaagcggccggtg
atgccgggtgtgctgatcctcgaggcgctcgcgcaggcggccgcgctgctgaccttcgcg
gaagagcagccgaaggatccggagaacacgctgtactacttcgtcggcatcgacggcgcg
cgcttcaagcgcgtggtcgagccgggcgaccagctgatcctgaacgtgacgttcgaacga
tacatccgcggcatctggaagttcaaggcggtggccgaagtggacggcaaggtggcggcg
gaagccgaactgatgtgcacggtcaagacggccgacgcggcgccctga

DBGET integrated database retrieval system