KEGG   Burkholderia vietnamiensis G4: Bcep1808_2311Help
Entry
Bcep1808_2311     CDS       T00493                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep1808_2311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvi02000]
    Bcep1808_2311
Enzymes [BR:bvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcep1808_2311
Transporters [BR:bvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep1808_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: ABO55310
UniProt: A4JGA7
LinkDB All DBs
Position
1:complement(2570036..2570692)
Genome map
AA seq 218 aa AA seqDB search
MLQLCGIPLSNYYNKVKFVLIEHDIPFEETQCSLPISDPALLADSPLGKIPFVKTEEGAL
FESQAIIEYLAARHPDKAIFPSAPFAAAKVRELVETLELYLEWTAREVYTEAFFGGKVSD
AMKAHVEKRLPRAIDAFKRLTQFSPYVLGDSFGLADIAAFVHLPVLGMATKAIYDRDFLL
DAGIDWKAHAKLVGARPAAQRVAADRKAYVEAANLARS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttgtgcggtattccgttgtccaactactacaacaaggtgaagttcgtgctg
atcgagcacgacatcccgttcgaggaaacccaatgcagcctgccgatcagcgatccggcg
ctgctggccgattcgccgctcggcaaaatcccgttcgtgaagaccgaagagggcgcgctg
ttcgagtcgcaggcgatcatcgagtatctggccgcgcggcatccggacaaggcgatcttc
ccgtcggcgccgtttgcggccgcgaaggtgcgcgagcttgtcgagacgctcgagctgtat
ctcgaatggaccgcgcgcgaggtctataccgaggcgtttttcggcgggaaggtgagcgac
gcgatgaaggcgcacgtcgagaagcgcctgccgcgcgcgatcgacgcgttcaagcggctc
acgcagttttcaccgtacgtgctcggcgatagcttcggtcttgccgacatcgccgcgttc
gtccatctgccggtgctcgggatggcgacgaaggcgatctacgatcgtgattttctcctc
gacgcgggcatcgactggaaggcgcacgcgaagctggtgggcgcacggcccgccgcgcag
cgcgtggccgccgaccgcaaggcgtacgttgaagcggcaaacctcgcgcgttcgtaa

DBGET integrated database retrieval system