KEGG   Burkholderia vietnamiensis G4: Bcep1808_2602Help
Entry
Bcep1808_2602     CDS       T00493                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00020  Citrate cycle (TCA cycle)
bvi00480  Glutathione metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
bvi01210  2-Oxocarboxylic acid metabolism
bvi01230  Biosynthesis of amino acids
Module
bvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep1808_2602
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep1808_2602
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bcep1808_2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phage_SSB
Motif
Other DBs
NCBI-ProteinID: ABO55597
UniProt: A4JH44
LinkDB All DBs
Position
1:complement(2879606..2880862)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHTYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGIKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGAEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGDVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgaaggcgacggtaccggc
ttcgacatcacgccggtgatgatcaaggtcgtcgatgcggcggtcgcgcatacgtacaag
ggcaagcgcaagatccactggatggagatcttcgccggcgagaaggcgacgaaggtgtac
ggcccggacgtatggctgcccgacgaaacgctgcaggtgctgaaggaatacgtcgtttcg
atcaaggggccgctcacgacgccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctctacgtgtgcctgcgcccgatccagtatttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgagtgggcggccggctccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcatc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtatgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggttatgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggtggcccgtggatgcgcgtgaagaacccgaagacgggcgccgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgccacgctgaacctgaacggcgactacgtctccgacgcactggccgcgcaggtcggc
gggatcgggatcgcgccgggtgcgaacctgtcggactcggtcgcgatgttcgaggcgacc
cacggcacggcgccgaagtacgcgggcaaggactacgtgaaccccggttccgagatcctg
tcggccgaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggtgcgacgcaggtgtcgtgctcgggcttcggcgacgtgctgatcgagaacatgtaa

DBGET integrated database retrieval system