KEGG   Burkholderia vietnamiensis G4: Bcep1808_3191Help
Entry
Bcep1808_3191     CDS       T00493                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00970  Aminoacyl-tRNA biosynthesis
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bcep1808_3191
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bvi03029]
    Bcep1808_3191
Enzymes [BR:bvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bcep1808_3191
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bcep1808_3191
Mitochondrial biogenesis [BR:bvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bcep1808_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ABO56182
UniProt: A4JIS9
LinkDB All DBs
Position
1:complement(3531705..3533177)
Genome map
AA seq 490 aa AA seqDB search
MTQWEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERA
IRFGLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPA
YEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKA
LHALVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVR
RQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQ
AGMPELPAAIQQRFVDQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGD
VSSQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFATIWDEKATDEGAADRI
IDAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQ
VNELLKKKLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatgggaagtcgtcatcggtctcgagacgcacgcgcaactgtcgaccgtctcg
aagattttctccggcgcgccgacgcagttcggcgccgagccgaacacgcaggcctgcccg
gtcgatctggcgctgccgggcgtgctgccggtgctgaaccgcggcgcggtcgagcgggcg
atccgcttcggcctcgcgatcggctcgaccatcgcgccgcgcagcatcttcgcgcgcaag
aattatttctaccccgatctgccgaagggctatcagatcagccagtacgagatcccggtc
gtccagggcggccagatcacgatccaggtgccggccaacgaaaaggccggcaagccggcg
tacgagaagacggtcaacctgacccgcgcgcatctcgaggaagatgcgggcaagtcgctg
catgaggacttcgccgggatgaccgggatcgacctgaaccgcgcgggcacgccgctgctc
gagatcgtcaccgagccggaaatgcgcagcgcggccgaggccgtcgcgtacgcgaaggcg
ctgcacgcgctcgtcgtgtggctcggcatctgcgacggcaacatgcaggaaggctcgttc
cgctgcgacgcgaacgtgtcggtgcgcccggtcggccaggagaagttcggcacgcgcgcc
gagatcaagaacctgaactcgttccgcttcctcgaggaggcgatcaactacgaagtgcga
cgccagatcgagctgatcgaggacggcggcgaagtcgttcaggaaacgcgcctgtacgat
ccggacaagcgcgagacgcgctcgatgcgcagcaaggaagacgcgcacgactaccgctac
ttccccgatcccgacctgatgccgctcgtgatcggccaggactggatcgagcgcgtgcag
gccgggatgcccgagctgccggccgcgatccagcagcgcttcgtcgaccagtacggcgtg
tccgcgtatgacgccggcgtgctgacgtcgagcaaggcgatggccgcgtacttcgaggcg
gtggtcgcgaaggccggcgcggcgaacgcgaagatcgccgcgaactggctgatgggcgac
gtatcgtcgcagctgaaccgcgacggcatcgagatcgacgcgattccggtgtcggccgcg
cagctcgcgctggtgctgcagcgcatcgccgacggcacgatctcgaacaagatcgcgaag
gaaatcttcgcgacgatctgggacgagaaggcaaccgatgaaggtgcggccgaccgcatc
atcgacgcgaagggccttaagcagatctccgacaccggcgcgctggaggcgatcatcgac
gaggtgctggcggcgaacgcgaaatcggtcgaggaattccgcgcgggcaaggagaaggcg
ttcaacgcgctgatcggccaggcgatgaaggcgaccaagggcaaggccaatccgcagcag
gtcaacgagctgttgaagaagaagctcggctga

DBGET integrated database retrieval system