KEGG   Burkholderia vietnamiensis G4: Bcep1808_3197Help
Entry
Bcep1808_3197     CDS       T00493                                 

Definition
(GenBank) cell elongation-specific peptidoglycan D,D-transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00550  Peptidoglycan biosynthesis
bvi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcep1808_3197
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bcep1808_3197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvi01011]
    Bcep1808_3197
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bcep1808_3197
Peptidoglycan biosynthesis and degradation proteins [BR:bvi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Bcep1808_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABO56188
UniProt: A4JIT5
LinkDB All DBs
Position
1:3538240..3540519
Genome map
AA seq 759 aa AA seqDB search
MTEFNDTQQQLSKFRLRVAAAGVFVFVCFGLLASRFFYLQLLQHGKYALQAEENRISVAP
IVPNRGIITDRNGVVLAKNYSAYTLEITPSKLDDTLDNTIDKLSEIVPIDARDRRRFKKL
QEDSKNFESLPIRTRLTDAEVARFTAQRFRFPGVDVRARLFRQYPLGMTAAHVIGYIGRI
SKRDQDRIDAMSDDNDSDPEHYDPRRDANNYKGTDYIGKIGVEQSYETELHGLTGFEEVE
VTAGGRPVRTLSRTQATPGDNLVLSLDIALQQVAEQAFAGKRGALVAIEPKTGDVLAFVS
SPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPPGSTYKPFMALAGLTLGKRTP
GWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSNDTYFYMLARDLGVNAIANFMKP
FGFGQITGIDIQGEARGILPSTEWKKKAFKKPAQQKWYDGETISLGIGQGYNSFTILQLA
HATATLANNGVVMKPHLVKEVEDPITRARHLTVPKESEVIPLKAADLDVVKRGMENVIDN
PSGTAYKVFRGAQYVAAGKTGTAQVFSLQGSNYKGHLLAEHLRDHALFIAYAPVDHPQIA
LALVVENGGWGAQSAGPIARRVLDYYLVERQNPKNEAAAVAAAASATEPVSAPVIGDATK
PVTVAAGFTALPPPVVPSAASAAQAASAASAPDAAATASAAPATEASAAAPRPASLPPIR
RPHRPRRPASDAQPLAAAPRDDNSRAAAAAKAANAGTAH
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcaacgacacccaacagcagctctcgaagttccgcctgcgcgtcgcggcg
gcgggcgtgttcgtgttcgtctgcttcgggctgctcgcgagccgcttcttctacctgcag
ctgctgcagcacggcaaatacgcgctgcaggccgaggaaaaccgcatctcggtcgcgccg
atcgtgccgaaccgcggcatcatcaccgaccgcaacggcgtggtgctcgcgaagaactac
tcggcgtacacgctcgagatcacgccgtcgaagctcgacgacacgctcgacaacacgatc
gacaagctgtccgagatcgttccgatcgacgcgcgcgaccgccgccgcttcaagaagctg
caggaagactcgaagaatttcgagagcctgccgatccgcacgcgcctgaccgacgccgaa
gtcgcccgcttcaccgcgcagcgcttccgcttccccggcgtcgacgtgcgcgcgcggctg
ttccgccagtatccgctcggcatgacggccgcgcacgtgatcggctatatcggccggatc
tcgaagcgcgaccaggatcgcatcgacgcgatgagcgacgacaacgacagcgatccggaa
cactacgatccgcgccgcgacgcgaacaactacaagggcaccgactacatcggcaagatc
ggcgtcgagcagagctacgagaccgagctgcacggcctgacgggcttcgaggaagtcgag
gtgacggccggcggccggcccgtgcgcacgctgtcgcgcacgcaggcgacgcccggcgac
aacctcgtgctgtcgctcgacatcgcgctgcagcaggtggcagagcaggcgttcgccggc
aagcgcggcgcgctcgtcgcgatcgagccgaagacgggcgacgtgctcgcgttcgtgtcg
tcgccgagcttcgacccgaactcgttcgtcgacggcatcgaccagcagacctgggacgag
ctgaacaactcgcccgacaagccgctcctgaaccgcccgctgcacggcacctacccgccc
ggctcgacgtacaagccgttcatggcgctggccggcctgacgctcggcaagcgcacgccg
ggctggggcttccaggatcccggctacttcacgttcggcggccacacgttccgcaacgac
gtgcgctcgggccagggctgggtcgacatgaacaaggcgatcatggtgtcgaacgacacc
tacttctacatgctcgcgcgcgacctcggcgtcaatgcgatcgcgaacttcatgaagccg
ttcgggttcggccagatcaccggcatcgacattcagggcgaggcgcgcgggatcctgccg
tcgaccgaatggaagaagaaggcgttcaagaagcccgcgcagcagaagtggtacgacggc
gagacgatcagcctcgggatcggccagggctacaactcgttcacgatcctgcagctcgcg
catgcgaccgcgacgctcgcgaacaacggcgtcgtgatgaagccgcacctggtgaaggaa
gtcgaggatccgatcacgcgcgcgcgccatctgacggtgccgaaggaaagcgaggtcatc
ccgctcaaggccgccgacctcgacgtcgtgaagcgcgggatggagaacgtcatcgacaac
ccgtcgggcaccgcgtacaaggtgttccgcggcgcgcagtacgtcgcggcgggcaagacc
ggcaccgcgcaggtgttctcgctgcagggctcgaactacaagggccacctgctcgccgag
catctgcgcgaccacgcgctgttcatcgcgtacgcgccggtcgaccatccgcagatcgcg
ctcgcgctggtcgtcgagaacggcggctggggcgcgcagtccgccggcccgatcgcacgc
cgcgtgctcgactactacctggtcgagcgccagaacccgaagaacgaggccgcggccgtg
gccgccgccgcatcggcgaccgagccggtgagcgcgcccgtgatcggcgacgcgacgaag
cccgtcaccgtggcggccggcttcacggcgctgccgccaccggtggtgccgagcgcagcg
agcgcggcgcaggccgcgtcggctgcgtcggcaccggatgctgcggcgaccgcaagcgcg
gcgccggcgaccgaggcgagcgctgcggcgccgcggcccgcgagcctgccgccgatccgg
cgcccgcaccggccgcgccggccggccagcgatgcgcagccgctcgcggccgcgccgcgc
gacgacaattcccgagccgcagccgccgcgaaggcggcgaacgccggcaccgctcattaa

DBGET integrated database retrieval system