KEGG   Burkholderia vietnamiensis G4: Bcep1808_3542
Entry
Bcep1808_3542     CDS       T00493                                 

Definition
(GenBank) HD phosphohydrolase-like protein
  KO
K21196  2-amino-1-hydroxyethylphosphonate dioxygenase (glycine-forming) [EC:1.13.11.78]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_3542
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.78  2-amino-1-hydroxyethylphosphonate dioxygenase (glycine-forming)
     Bcep1808_3542
SSDB
Motif
Pfam: HD
Other DBs
NCBI-ProteinID: ABO56529
UniProt: A4JJS6
LinkDB
Position
2:complement(272231..272782)
AA seq 183 aa
MALTVDEIDGLYRAHGHVAYSGEPVTQLEHALQCGLLAEEADADDALIAAAFLHDLGHLL
NRQGDTPSARGIDDLHQYYVLPFLRPLFGDAVLEPIRLHVDAKRCLCRTEAGYVDGLSAD
SVRSLALQGGIFDDDDAAAFLRRPFAADALRLRRWDDRAKEQGKVTPGLDHYMEIVARQA
RTG
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcactgaccgtggacgagatcgacgggctgtatcgcgcgcacggtcatgtcgcgtac
agcggcgaaccggtgacgcagctggagcatgcgctgcagtgcggcttgctggcggaggaa
gccgacgcggacgacgcgctgatcgcggcggcgttcctccacgatctcgggcatctgctg
aaccggcagggcgacacgccgagcgcacgcggcatcgacgatctgcaccagtattacgtg
ctgccgttcctgcggccgctgttcggcgacgcggtgctggagccgatccggctgcacgtc
gacgcaaagcgctgcctgtgccgtacggaagcgggctacgtcgacggcctgtcggcggat
tcggtgcgcagcctcgcgctgcagggcggcatcttcgatgacgacgatgcggcggcattc
ctgcggcgcccgttcgccgcggatgcgctgcgcctgcgccgctgggacgacagggccaag
gagcagggcaaggtcacgccgggccttgatcactatatggaaatcgtggcccgccaggcg
cggacgggctga

DBGET integrated database retrieval system