KEGG   Burkholderia vietnamiensis G4: Bcep1808_3544
Entry
Bcep1808_3544     CDS       T00493                                 

Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_3544
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     Bcep1808_3544
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: ABO56531
UniProt: A4JJS8
LinkDB
Position
2:complement(274238..275548)
AA seq 436 aa
MNAAFSLRLPGEHVRAGNLSADLAARCVDVNGRRYRLPVEPTVVVCVDGCEYDYLERAVA
AGVAPFLGRMIAEGTAWRADSVVPTFTNPNNLSIVCGVPPSVHGICGNYFWDATADGGRG
AEVMMNDPSYLRAGTLLAAASDAGARVAVVTAKDKLRRLLGWRMNGICFSAEKAAQANLA
ENGIVDVLDWVGLPSPDVYSAALSEFVFAAGVRLAQTRQVDLMYLSTTDYVQHKCEPGSA
GANAFYAMMDRYLAQLDALGWAIGLTADHGMNAKHDPATGRPNVVYLQDAFDRWFGAQSA
RVILPITDPYVVHHGALGSFATVYLAPGVDRTDAMWRIGDLDGIELVLDNAEAAARFELP
ADRIGDLVVVARRDTAVGTREREHDLSGLTVPLRSHGGVSEQEVPLIFNRRIEPRDPARR
PRNFDVFDFVLNRIAS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaacgccgcattctccttgcgactgcccggtgagcacgtgcgtgccggcaacctttcg
gccgatctcgcggcgcgctgcgtcgacgtgaacggccggcgctatcggctgccggtcgag
ccgacggtcgtcgtctgcgtcgacggctgcgagtacgactatctcgagcgcgcggtggcg
gccggcgtcgcgccgttcctcggccgcatgatcgcggagggcaccgcgtggcgcgccgac
agcgtcgtgccgaccttcacgaacccgaacaacctgtcgatcgtttgcggcgtgccgccg
tcggtgcacggcatctgcggcaactacttctgggacgcgaccgccgacggcggccgcggc
gccgaagtgatgatgaacgatccgtcctacctgcgcgccggcacgctgctcgcggcggcg
tccgacgccggcgcgcgcgtggccgtggtcaccgcgaaggacaagctgcgccggctgctc
ggctggcggatgaacggcatctgcttttccgccgagaaggccgcccaggccaatctcgcg
gaaaacggcatcgtcgacgtgctcgactgggtcggcctgccgtcacccgacgtatacagc
gcggcgctgtccgaattcgtgttcgcggccggcgtgcggctggcgcagacgcggcaggtc
gatctgatgtacctgtcgaccaccgactacgtgcagcacaagtgcgagcccggcagcgcg
ggcgcgaacgcgttctacgcgatgatggaccgctatctcgcgcaactcgacgcgctcggc
tgggcgatcgggctcacggccgaccacgggatgaacgcgaagcacgatccggccaccggc
cgtccgaacgtggtctatctgcaggacgcgttcgaccgctggttcggcgcgcagtccgcg
cgcgtgatcctgccgatcaccgacccgtacgtcgtgcatcacggcgcgctcggctcgttc
gcgacggtctacctcgcgccgggtgtcgaccggaccgacgcgatgtggcgcatcggcgac
ctcgacggcatcgagctcgtgctcgacaacgcggaagccgctgcgcgcttcgagctgccg
gccgaccggatcggcgatctcgtggtggtcgcgcgccgcgacacggccgtcggcacgcgc
gagcgcgagcacgacctgtccggcctgaccgtgccgctgcgctcgcatggcggcgtgtcc
gagcaggaagtgccgctgatcttcaaccgccggatcgagccgcgcgacccggcgcgccgt
ccgcgcaacttcgacgttttcgatttcgtgctgaaccggatcgcgtcatga

DBGET integrated database retrieval system