KEGG   Burkholderia vietnamiensis G4: Bcep1808_3841
Entry
Bcep1808_3841     CDS       T00493                                 

Definition
(GenBank) trans-feruloyl-CoA hydratase / vanillin synthase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00998  Biosynthesis of various secondary metabolites - part 2
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    Bcep1808_3841
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     Bcep1808_3841
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ABO56824
UniProt: A4JKM1
LinkDB
Position
2:599476..600303
AA seq 275 aa
MGYEGRWKTVKVEVAGGIAWVTLNRPEKRNAMSPTLNTEMIDVLEAIELDADAQVLVLTG
EGDAWTAGMDLKEYFREIDAGPEILQEKIRRDASRWQWQLLRMYAKPTIAMVNGWCFGGG
FSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHREALYYIMTGDTFTGQQ
AARMGLVNKSVPRAQLRDEVRALAAKLLDKNPVVIRNAKHGFKRCRELTWEQNEDYLYAK
LDQANYRDPEGGREQGLKQFLDDKSIKPGLQAYKR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggttacgaagggcgctggaaaacggtgaaggtcgaggtcgcgggcggcatcgcatgg
gtgacgctgaaccgtccggaaaagcgcaacgcgatgagcccgacgctgaacacggagatg
atcgacgtgctcgaggcgatcgagctcgacgccgacgcgcaggtgctggtgctgaccggc
gaaggcgatgcatggacggccgggatggacctgaaggagtacttccgcgagatcgacgcg
ggcccggaaatcctgcaggagaagattcgccgcgacgcgagccgctggcagtggcaattg
ctgcgcatgtacgcgaagccgacgatcgcgatggtcaacggctggtgcttcggcggcgga
ttctcgccgctggtcgcctgcgacctcgcgatcgcggccgacgaggcggtgttcgggctg
tcggaaatcaactggggcatcccgccgggcaacctcgtcagcaaggcgatggcggacacc
gtcgggcatcgcgaggcgctctactacatcatgaccggcgatacgttcaccggccagcag
gccgcgcggatggggctcgtcaacaagagcgtgccgcgcgcgcagctgcgtgacgaagtg
cgcgcgctcgcggcgaagctgctcgacaagaatccggtcgtgatccgcaacgcgaagcac
ggcttcaagcgctgccgcgagctgacctgggagcagaacgaggactacctgtacgcgaag
ctcgaccaggccaactatcgcgacccggaaggcgggcgcgagcagggcctcaagcagttc
ctcgacgacaagagcatcaagccgggcctgcaggcgtacaagcgctga

DBGET integrated database retrieval system