KEGG   Burkholderia vietnamiensis G4: Bcep1808_4412Help
Entry
Bcep1808_4412     CDS       T00493                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00020  Citrate cycle (TCA cycle)
bvi00190  Oxidative phosphorylation
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
Module
bvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep1808_4412
   00650 Butanoate metabolism
    Bcep1808_4412
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcep1808_4412
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcep1808_4412
    1.3.5.4  fumarate reductase (quinol)
     Bcep1808_4412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 HI0933_like Lycopene_cycl GIDA Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABO57378
UniProt: A4JM75
LinkDB All DBs
Position
2:1237330..1239105
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALRFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVQHVKNQRDHKPLPADAGEYSLARLAKLEKSTSGEYTQDVANDIRSTMQKHAGVFRTS
ALLKEGVDQMAGLKERVENIHLKDKSKVFNTARIEALELENLIEVARATMVSAEARKESR
GAHAHSDYEHRDDDNWLRHTLWYSEGDRLDYKPVQMKPLTVDSVPPKPRTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgccgcaagttcgacgtggtgatcgtcggcgcc
ggcggctcgggcttgcgcgcagcgctgcaactgtcgcgtgcgggcctgtcggtcggcgtg
ctgtcgaaggtgttcccgacccgttcgcacacggtcgcggcacaaggcggcatcggcgcg
tcgctcggcaacatgagcgaagacaactggcacttccatttctacgacacgatcaagggt
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgtgaagcgccgaacgtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaacgcggacggcacgatctac
cagcgcccgttcggcggccacaccgcgaactacggcgagaagccggtgcagcgcgcttgc
gcggccgccgaccgtaccggtcacgcgctgctgcacacgctgtaccagcagaacgtcgag
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgagatggagacgggcgacgtctacatcatggaaggc
aagacgacgctgttcgcgacgggcggcgctggccggatcttcgcggcatcgacgaacgcg
ttcatcaacacgggcgacgggctgggcatggccgctcgctcgggcatcgcgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcacggaa
ggcgtgcgcggcgagggcggcattctgcgcaactcgaacggcgagcgcttcatggagcgc
tatgcgccgacgctgaaggatctggcgccgcgtgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtcggtccgaacaaggaccacgtgctgctggatctgtcg
cacatcggcgcggagacgatcatgaagcgtctgccgtcgatccgcgagatcgcgctgcgg
ttcgcgaacgtcgactgcatcaaggaaccgatcccggtcgtgccgacgatccactaccag
atgggcggcattccgaccaacatccacggtcaggtcgtgggcacgtcgcgcgatcacaag
gagccggtcaacggcttctacgcggtcggcgaatgctcgtgcgtgtcggtgcacggcgcg
aaccgcctgggcacgaactcgctgctcgacctggtggtgttcggccgcgcggccggcaac
cacatcgtccagcacgtgaagaaccagcgcgaccacaagccgctgccggccgacgcgggc
gaatactcgctggcacgcctggcgaagctcgagaagtcgacgtcgggcgaatacacgcag
gacgtcgcgaacgacatccgctcgacgatgcagaagcatgcgggcgtgttccgtacctcg
gcgctgctgaaggaaggcgtggaccagatggccggcctgaaggagcgggtggaaaacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcatcgaagcgctcgagctggag
aacctgatcgaagtggcccgtgcaacgatggtgtcggccgaagcgcgcaaggaaagccgc
ggcgcacacgcgcacagcgactacgagcaccgcgacgacgacaactggctgcgccacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagccggttcaaatgaagccgctgacg
gtcgactccgtgccgccgaagccgcgcacgttctaa

DBGET integrated database retrieval system