KEGG   Burkholderia vietnamiensis G4: Bcep1808_4413Help
Entry
Bcep1808_4413     CDS       T00493                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00020  Citrate cycle (TCA cycle)
bvi00190  Oxidative phosphorylation
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
Module
bvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep1808_4413
   00650 Butanoate metabolism
    Bcep1808_4413
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcep1808_4413
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcep1808_4413
    1.3.5.4  fumarate reductase (quinol)
     Bcep1808_4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: ABO57379
UniProt: A4JM76
LinkDB All DBs
Position
2:1239127..1239828
Genome map
AA seq 233 aa AA seqDB search
MAKRIFELYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKAVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMTHFFNQYHSIKPYLIND
APPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcatttttgaactctatcgctacgatccggacaaggacgcggcgccgcgc
atgcagacgtacgagctcgagatccagcatgagcgcatgctgctcgacgcgctggtgaag
ctgaaggccgtggacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggtctcgcgtgcctgacgaacctgaacgat
ctgccgcagaagatcgtgctgcgtccgctgccggggctgccggtggtgcgcgacctgatc
gtcgacatgacgcacttcttcaaccagtatcactcgatcaagccgtacctgatcaacgac
gcgccgccgccggagaaggaacgcctgcagtcgccggaagagcgcgacgagctcgacggc
gtgtacgagtgcattctgtgtgcgagctgctcgacgtcgtgcccgagcttctggtggaac
ccggacaagttcgtgggcccggcgggcctgctgcaggcttaccggttcatcgccgacagc
cgcgacaccgccaccggcgagcgtctcgacaatctggaagatccgtaccgtctgttccgt
tgccatacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaatccgacgaaggcg
atcggcaagatcaaggaactgatggttcgccgcgcggtttaa

DBGET integrated database retrieval system