KEGG   Burkholderia vietnamiensis G4: Bcep1808_4685
Entry
Bcep1808_4685     CDS       T00493                                 

Definition
(GenBank) aminotransferase, class V
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_4685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bvi01007]
    Bcep1808_4685
Enzymes [BR:bvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     Bcep1808_4685
Amino acid related enzymes [BR:bvi01007]
 Aminotransferase (transaminase)
  Class V
   Bcep1808_4685
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_1_2 SHMT
Other DBs
NCBI-ProteinID: ABO57643
UniProt: A4JMZ0
LinkDB
Position
2:complement(1521126..1522190)
AA seq 354 aa
MLLLNPGPVTLSERVRRSLLQPDLCHRESEFFDLQDEARARLVAAYELDPAEWAAVLMTG
SGTAAVESMIAALVPQDGKLLVIENGVYGERITQIATQYGIAHDVLKHEWMQAPDVAEVA
ARLDAGGYSHVAVIHHETTTGRLNDLGAIADVCRARGVRMLVDGVSSFGAEAIDFGGGVI
DAVAATANKCLHGVPGAAFVIVRRSALTKAASRTYYLDLGRLAKLQDQRNTPFTPSVHAY
YALVEALREFDEAGGWRARHARYKALADQVQAGLAARGMPLVLPDGESSVVLRAYRLPQG
VAYEALHDGLKARGFVIYAGQGGLSKELFRISTMGAIEAADVERLLEGFTALTR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgctgctcaatcccggcccggtcacgctcagcgaacgcgtgcgccgcagcctgctg
caaccggacctgtgccatcgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtatgagctcgatccggccgaatgggccgccgtgctgatgaccggc
tcgggcaccgccgccgtcgaaagcatgatcgcggcgctcgtgccgcaggacggcaagctg
ctcgtgatcgagaacggcgtatatggcgagcgcatcacgcagatcgcgacgcagtacggg
atcgcgcacgacgtgctgaagcacgaatggatgcaggcgcccgatgtcgcggaagtcgcc
gcgcggctcgacgcgggcggctattcgcacgtcgcggtgattcatcatgagacgacgacg
ggccggttgaacgatctcggtgcgatcgccgacgtgtgccgtgcgcgcggcgtgaggatg
ctcgtcgatggcgtgagcagcttcggcgccgaggcgatcgacttcggcggcggcgtgatc
gatgccgttgccgcgaccgcgaacaagtgcctgcacggcgtgcccggtgccgcattcgtg
atcgtgcgtcgcagcgcgctcacgaaggccgcgagccggacttactatctcgatctcggc
cggctggcgaagctgcaggatcagcgcaatacgccgtttacgccttcggtgcatgcgtat
tacgcgctcgtcgaagcgttgcgcgagttcgacgaagccggcggctggcgcgcgcggcat
gcgcgttacaaggcgctcgccgatcaggttcaggccgggctcgccgcacgagggatgccg
ctggtgttgcctgacggtgaatcgtcggtcgtgttgcgtgcgtaccggttgccgcagggc
gtggcgtatgaagcgctgcacgacgggttgaaggcgcgcgggttcgtcatctatgccggg
caaggcgggttgtcgaaggagctgttccgcatctcgacgatgggcgcgatcgaggccgcg
gatgtcgagcggttgctggaggggtttacggcgttgacgcggtga

DBGET integrated database retrieval system