KEGG   Brucella vulpis: BF3285c1_0025Help
Entry
BF3285c1_0025     CDS       T04257                                 

Gene name
ddl1
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bvl  Brucella vulpis
Pathway
bvl00473  D-Alanine metabolism
bvl00550  Peptidoglycan biosynthesis
bvl01100  Metabolic pathways
bvl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF3285c1_0025 (ddl1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BF3285c1_0025 (ddl1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BF3285c1_0025 (ddl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvl01011]
    BF3285c1_0025 (ddl1)
Enzymes [BR:bvl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BF3285c1_0025 (ddl1)
Peptidoglycan biosynthesis and degradation proteins [BR:bvl01011]
 Precursor biosynthesis
  Amino acid ligase
   BF3285c1_0025 (ddl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CUW42730
UniProt: A0A0U5MKF0
LinkDB All DBs
Position
1:complement(25553..26479)
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERSVSLSSGAACATTLEECGYRVTRIDVDRNVASILVELKPDVVF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVAVAPSRLMNR
FDIGSQYPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVVGSADWRYGDEVMVEGYIAGR
ELTCAVMGDRAMDVCEIIPVGYQFYDYDSKYVAGASTHVCPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaacacgtcgccgttttgatgggtggtttttcttcggaacgctccgtcagc
ctttcctccggtgcagcctgcgcaacgacgcttgaagaatgcggctatcgcgtcacgcgc
attgatgtggatcgcaatgttgcgagcatcctggtcgagttgaaacccgatgttgtgttc
aacgccttgcacggccctttcggcgaagatggcgccattcagggcgtgcttgaatatctc
cagattccctacacgcattccggcgtgctggcttccgcgcttgcgatggacaaggatcgc
gccaagaaggtggcggcagcggcgggcgtcgcggttgcgccgtcacgcctgatgaaccgt
ttcgacattggttcgcagtatccgatgaagccgccttacgtggtgaagccggtgcgtgaa
gggtcgagcttcggtgtggtgatcgtcaaggaagatcagccgcatccgccgcaggtcgtc
ggttcggccgattggagatatggcgatgaggtcatggtcgaaggctatattgccgggcgt
gagctgacctgtgccgtgatgggggatcgcgccatggatgtgtgcgagatcattccggtc
ggttatcagttctacgactatgattcaaaatatgttgcaggcgcatcaactcacgtgtgc
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagccggtcggacttccgtttcgatgatcgtttttct
gaagaaggcgaagttgtctggctggaaatcaatacccagccgggaatgactcctacctcg
ctcgtgcctgatatcgccaaagcggcgggtatctctttcgctgagttgttgagttggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system