KEGG   Brucella vulpis: BF3285c1_0481Help
Entry
BF3285c1_0481     CDS       T04257                                 

Definition
(GenBank) 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bvl  Brucella vulpis
Pathway
bvl00010  Glycolysis / Gluconeogenesis
bvl00620  Pyruvate metabolism
bvl01100  Metabolic pathways
bvl01110  Biosynthesis of secondary metabolites
bvl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3285c1_0481
   00620 Pyruvate metabolism
    BF3285c1_0481
Enzymes [BR:bvl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BF3285c1_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CUW43181
UniProt: A0A0U5G3I3
LinkDB All DBs
Position
1:complement(469485..471002)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPKSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAAKELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVDIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRVLIQESIYDRFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgaattcagccggacggtgaaaccggcttttgcaaaacgctatggcaat
ttcattggcggcaaatgggtggaacccaagtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccaaggagctatggggcaggacaagtgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggctgccgcc
gaaacatgggacaacggcaagccgatccgtgaaaccaccaatgccgacctgccgctggca
gtcgatcatttccgctatttcgcgggcgtcatccgcgctcaggaaggcggtatttctgaa
atcgatcacgatactgtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgcg
ggcaattgcgtggtgctgaaacccgccgaacaaaccccggcttccatcctcgtgctgatg
gagcttattgccgatattctgccgccgggcgtggtcgatatcgtcaatggtttcggcctt
gaagccggcaagccgctggcatccagcccccgtatcgccaaaatcgccttcacgggtgag
acgacgacgggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacactg
gagctgggcggcaagtcacccaacattttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggcgattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgtgctcattcaggaatcgatctatgacaggttcatggaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggctacgatgattggc
gcgcaggcatcgagcgaacagctcgaaaaaatcctgagctatctcgatatcggccgtcag
gaaggtgcggaagtgctggcaggcggcgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggcctgtcgtgtccgtcgcaaccttcaaggatgatgcggaggcgctatcg
attgccaatgacacgctctatggcctcggtgcgggcatatggacgcgcgacggcacacgc
gcctatcgcttcggtcgcgccattcaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcggccgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagcccgaag
aagctcggcttcttctaa

DBGET integrated database retrieval system