KEGG   Brucella vulpis: BF3285c1_0483Help
Entry
BF3285c1_0483     CDS       T04257                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bvl  Brucella vulpis
Pathway
bvl00564  Glycerophospholipid metabolism
bvl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BF3285c1_0483 (glpD)
Enzymes [BR:bvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BF3285c1_0483 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CUW43183
UniProt: A0A0U5MP08
LinkDB All DBs
Position
1:complement(472338..473849)
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARLVALTARDAADRGAMIATRTSVV
AASRDGQGWTIMLEDTGTGRRENVHACLLVNAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHAAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGCHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggaacctcttcgcgcgccaccaagctcattcatggcggcttgcgctatctggaa
cattatgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgccgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgtaccgacaaggccggcgaaccgctgaagccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcctcgtggcg
ctcaccgcccgcgatgcggccgatcgcggcgcgatgatcgcgacccgaacgagcgtcgtt
gccgcaagccgcgacgggcagggctggaccatcatgttggaagataccggcaccggcagg
cgtgagaacgtacatgcctgccttctggtcaatgccgccggaccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtacagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaatgacggg
cgcatcattttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcactgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgatggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccggatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacggcgcgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggtgcgccatggacccatgcagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggctgtcatttcggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagacattttgtggcggcgcaccaag
ctcggcctgcgcctgactgcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctga

DBGET integrated database retrieval system