KEGG   Bacillus vallismortis: B9C48_00430Help
Entry
B9C48_00430       CDS       T04948                                 

Definition
(GenBank) molecular chaperone Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bvm  Bacillus vallismortis
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bvm03110]
    B9C48_00430
Chaperones and folding catalysts [BR:bvm03110]
 Heat shock proteins
  HSP33
   B9C48_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ARM26413
UniProt: A0A1W6HE29
LinkDB All DBs
Position
80446..81321
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLILGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggtaaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcgtctctgatactcggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaacccgcacgttcattttgacctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacggggcaagtagagattgtctcgggtgaactcggt
gatgacttcacgtattaccttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctagtaaatcctgataacacgattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaatcgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system