KEGG   Bacillus vallismortis: B9C48_00715Help
Entry
B9C48_00715       CDS       T04948                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bvm  Bacillus vallismortis
Brite
Translation factors [BR:bvm03012]
 Eukaryotic Type
  Elongation factors
   B9C48_00715
 Prokaryotic Type
   B9C48_00715
Mitochondrial biogenesis [BR:bvm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B9C48_00715
Exosome [BR:bvm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B9C48_00715
  Exosomal proteins of breast cancer cells
   B9C48_00715
  Exosomal proteins of colorectal cancer cells
   B9C48_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: ARM26454
UniProt: A0A1W6HEC6
LinkDB All DBs
Position
133409..134599
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEYEEKILELMAAVDEYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIINLPEGVEMVMPGDNTE
MIVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatatcggtacaattggacac
gttgaccatggtaaaacaacattaactgctgctatctcaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgtgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgacactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgtagtattccttaacaaatgcgac
atggtagacgacgaagagcttcttgagcttgttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggtgacgctgagtacgaagaaaaaattcttgaacttatggctgcagttgatgagtac
atcccaactccagaacgcgacactgacaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagaaaacagcaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgactatgctgaagctggagacaacatcggtgcactt
cttcgcggtgtagctcgtgaagacatccaacgtggacaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatcaatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgatcgttgaacttatctctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtacagttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system