KEGG   Bacillus vallismortis: B9C48_01785Help
Entry
B9C48_01785       CDS       T04948                                 

Definition
(GenBank) nitrite reductase
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00910  Nitrogen metabolism
bvm01100  Metabolic pathways
bvm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    B9C48_01785
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     B9C48_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: ARM26637
UniProt: A0A1W6HF46
LinkDB All DBs
Position
complement(328858..330990)
Genome map
AA seq 710 aa AA seqDB search
MTEPMLRYFRDKLQDIQSEKTYETQCPFCSMQCKMQLTEQTFAARKKYTAIGIDNPTTHG
RLCTKGMNAHQHAVHSSRITRPLFKKNGEFVPVSWAEALNRIKEQINLIQTEHGNDAMAV
YGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAGQTFGADRGLTNPLSDIP
HTRVIILAGTNIAECQPTIMPYFDKAKENGAYIIAIDPRETATTKIADLHLKIKPGTDAA
LANGLVKICIDEQLTDKDFIRTRTNGFDKLKRHTDALDLKEISEQTSVPLEHMRKAAVKF
AKETSGMLFTARGIEQQTDGTAAVKAFLNMVLITGKIGKPFSGYGAITGQGNGQGAREHG
QKADQLPGYRSIEIEEHRAYIAKVWGIHQDELPRKGVSAYEMIEKIASGDIKGLFLMCSN
PAVSGPNANFVKQAIKKLRFFVAVDLFISETAAFADVILPASSYLEDEGTMTNVEGRVTL
REASRTCPGEAKHDWQIICDIASALGKGHYFPYTSAEEIFNELREASRGGIADYAGITYD
RLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAALSVIPNEPPVPKEKPSADYPLYLT
TGRVMSHYLTGVQTRKSSALAARHFESFVEIHPKTAADYHIEDRVLVKIESPRGSITVRS
RWSENVRKDTLFVPIHWSDTQNVNDLIGEALDPDCKMPGFKMCAVRISPI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaaccgatgctccgttatttccgtgacaaactgcaagatattcaatcggaaaaa
acatatgagacgcaatgcccgttctgcagcatgcaatgcaaaatgcagcttacggaacaa
accttcgcggcacggaagaaatacactgcaatcggcattgataatccgacgacacatggc
cgtttatgtacaaaaggcatgaatgcccatcagcatgccgtgcactcttcccgcattaca
cgccccctgtttaaaaaaaacggtgaatttgtgcctgtctcttgggctgaagcactgaat
cgcattaaggaacaaatcaatctgatccaaaccgaacacggcaatgatgcgatggccgtc
tacgggagcgcctccattacaaatgaagaagcctatctgctaggaaagttcgcacgggtc
ggcttacagacgaaatacatcgattacaacgggcggctctgtatgtctgccgcagcaacg
gcggccggccagacattcggcgcggacaggggcctgacgaatccattatcggacattccg
catacacgcgtcatcatcctggcaggcaccaatatcgcggaatgccagccgacgatcatg
ccgtattttgataaagcgaaagaaaacggggcttacattatcgccattgatccccgggaa
acggcgacgaccaaaatagccgatcttcacctgaaaatcaagcccggcacagacgccgcc
ctggcaaacggactcgtcaaaatctgcattgacgaacagcttacagacaaagactttatc
cgcacacgaacaaacggattcgataagctcaaacggcataccgacgctttagatctgaaa
gagatttccgagcagacaagtgttcctttggagcatatgcgaaaggccgccgtgaagttt
gccaaggaaacatccggcatgctgtttacagcgcgggggatcgaacagcagactgacggt
accgcggcggtgaaagctttcttaaatatggtgctgatcacgggaaaaatcggcaagccc
ttctcaggttacggggcgattaccggtcaaggcaacggacaaggcgcgcgagaacacggc
caaaaagcggatcagcttccgggctaccgttctatcgaaattgaagaacaccgggcgtat
attgcgaaggtgtgggggattcatcaggatgagctgccgcgaaaaggcgtctcagcctat
gaaatgatagaaaaaatagctagcggcgacatcaaaggactgtttctcatgtgttccaat
ccggctgtttccggcccaaatgcgaatttcgtcaagcaagcaatcaagaaactgagattc
tttgtcgcagttgatttatttatttctgagaccgcggcattcgcagatgtgattttaccc
gcctcctcttatttggaagacgaaggcacgatgacaaatgtagaaggccgcgtgacatta
agagaagcgagccgcacctgccccggagaagcgaaacatgattggcagattatctgtgac
attgcctcggctcttggtaaagggcattattttccctatacgtcagcggaggaaatcttt
aacgaactgagagaagcgagccgcggcggaattgctgattacgctggcatcacctatgac
aggctcaggcgggaaggcggcattcattggccgtgtccggaatctgatcatcccggaact
gggcgcttgtttacagaatcatttgctcatccggatcaaaaagcggcattaagtgtgatt
ccaaacgaaccacctgttccaaaagagaaaccgtcagccgattatccgctttatttaacg
acaggcagagtcatgtctcactacttaacgggtgtccaaacgagaaaaagctctgccttg
gctgcaagacatttcgaatcctttgtggaaatccacccaaaaacggcggccgactatcat
atcgaagaccgtgttctcgtgaagatagaatccccccggggcagcatcacggtccggagc
agatggtcggaaaacgtacgaaaagacacgttgtttgtccccatccattggtctgacacg
caaaacgtcaacgatttaattggtgaagccttggatccggactgtaaaatgcccggtttt
aagatgtgcgcggtacgaatcagccctatataa

DBGET integrated database retrieval system