KEGG   Bacillus vallismortis: B9C48_02275Help
Entry
B9C48_02275       CDS       T04948                                 

Definition
(GenBank) glycosyltransferase
Organism
bvm  Bacillus vallismortis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-ProteinID: ARM26730
UniProt: A0A1W6HFC0
LinkDB All DBs
Position
447490..448752
Genome map
AA seq 420 aa AA seqDB search
MSNILFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRAMMGELPKVSVLIPAHNE
EVVIRQTLKAMVNLYYPKERLEIIVVNDNSSDRTGDIVNEFSRQYDFIKMVITKPPNAGK
GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT
ILTKFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEQLGGWDDKALAEDTELT
IRVYNLGYHIRFFPAAVTWEQEPETWKVWWRQRTRWARGNQYVVLKFLSQFFKLKRKRII
FDLFYFFFTYFLFFFGVIMSNTIFIINLFYDLHLAVGFLAMILWILAFFLFMTEVMITLS
IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIWSLFTEIKHRLFKQEVKWYKTERYNQNKSG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaacattctgttttttatctcattaagtttaatatgggtgatgcttctctatcac
atgtttctgatgcagggcggattcaggcattatatgaccttcgaacggaacattccgaaa
tggcgcgcaatgatgggggagctcccgaaggtcagcgtgctcattcccgcgcataatgag
gaggtcgtcatcaggcagacgctgaaggcgatggtgaacctgtattatccgaaagaaagg
cttgagatcatcgtcgttaacgataattcctccgaccggacgggagacatcgtcaatgaa
ttttcccgtcagtatgacttcattaaaatggtcatcacaaagcccccgaacgccggaaaa
ggaaaatcttcggcgctgaactcagggttcgcggaatcgaacggagacgtgatctgcgtg
tatgatgcagacaatacgccggaaaaaatggcggtgtactacctggttctcggtctgatg
aatgatgagaaagcgggagcggttgtcgggaaattccgtgtcatcaatgcggccaaaacg
atcctgacgaagtttatcaatatagaaaccatctgctttcagtggatggcgcagggcggc
agatggaaatggttcaaaatcgccaccatcccgggaacgaacttcgcgatcaggcggagc
attatcgaacagctcggcggctgggatgataaggcgctggcggaggataccgagctgacc
atccgcgtgtataatctcggctaccatatccgctttttcccggcggctgtgacatgggag
caggagcctgagacatggaaggtctggtggcgtcagcggacaagatgggcgcgcggcaac
caatacgttgttctcaagtttttatcccaatttttcaagctgaaacgcaagcggatcatc
ttcgatctgttttatttcttttttacgtattttttgtttttcttcggtgtgatcatgtca
aacacgatttttatcatcaatcttttttacgacctgcatctggcagtcgggtttttggcg
atgattttgtggatactggcctttttcctgtttatgactgaggtcatgattactttaagc
attgaaaaaacagaaatgaacaaacaaaacttctttatcgtatttctgatgtactttaca
tactcccaggcttggatcgtgctcgtcatctggtcattattcacagagattaagcaccgc
ttgttcaagcaggaagtcaagtggtacaaaacggagcgatacaatcaaaataaaagcggg
tga

DBGET integrated database retrieval system