KEGG   Bacillus vallismortis: B9C48_02475Help
Entry
B9C48_02475       CDS       T04948                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00473  D-Alanine metabolism
bvm00550  Peptidoglycan biosynthesis
bvm01100  Metabolic pathways
bvm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B9C48_02475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B9C48_02475
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B9C48_02475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvm01011]
    B9C48_02475
Enzymes [BR:bvm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B9C48_02475
Peptidoglycan biosynthesis and degradation proteins [BR:bvm01011]
 Precursor biosynthesis
  Amino acid ligase
   B9C48_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ARM26764
UniProt: A0A1W6HFA9
LinkDB All DBs
Position
479934..481019
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGEWQRGPLLTEPVSN
VKMLQLEQNGESFALSALNREMFPEASPDEKATIDVVFPLLHGPNGEDGTIQGLLELLNV
PYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEEELGYPC
FVKPANLGSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPKCS
AVGEIAPKTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADF
FLTNDGQVLINEVNTMPGFTPFSMFPLLWKEAGVDYSDLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggaaagtcagccgaacacaatgtatcgctg
cagacagcattagctgtaacaaaagcgcttaatactgagaagtttgatatacatccgatt
tacatcactgaaaaaggagaatggcaaagaggcccgctgctgactgagccggtttccaac
gtgaaaatgcttcagctggaacaaaacggtgaaagttttgctctatcagcattgaaccgg
gaaatgtttcctgaagcgtcgcctgacgaaaaggcgacgatcgatgtcgtatttccgctt
ctgcacggaccgaacggtgaagacggcaccattcagggtctgctggaattgctgaacgtt
ccttatgtcggcaacggagtgcttgcatcatcagccggcatggataaagtcatcatgaag
catttgttcgctcaagcggggcttccgcaggcgaagtacgccgctttcttaaaaaaggac
tggaaacagacgccggacagctgcttacagcaggttgaagaggagctgggatatccgtgc
ttcgtcaaaccggcgaacctcggatcaagcgtcggaatcagcaaatgccgaaaccgtgaa
gagcttgaaaaagccttcgaactggcttttgagtatgaccggaaaattgtggtggaagaa
ggaatcgccggaagagaaatcgaaatcggcgtactcggaaatgacgaaccgaaatgctcc
gccgtcggtgaaatcgcgccgaaaaccgacttttacgattacaaggcgaaatatgaagac
ggcgacacggatttaatgattcccgcgcaagtgacggatgaacaatatgcggaaatcagc
gaaatggcgattaaagccttcaaagcgattgacggatcaggccttgtccgcgccgatttc
ttcctgaccaatgacgggcaagtgctcattaacgaagtgaacacaatgccgggctttacg
ccattcagcatgttcccgctgctttggaaagaagcaggcgtagattacagtgatctgatc
gaacagctggttgagctggcaaaagaacgccatgccgaaaaacagctgattaaacataca
ttttaa

DBGET integrated database retrieval system