KEGG   Bacillus vallismortis: B9C48_02515Help
Entry
B9C48_02515       CDS       T04948                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00473  D-Alanine metabolism
bvm01100  Metabolic pathways
bvm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B9C48_02515
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B9C48_02515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvm01011]
    B9C48_02515
Enzymes [BR:bvm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B9C48_02515
Peptidoglycan biosynthesis and degradation proteins [BR:bvm01011]
 Precursor biosynthesis
  Racemase
   B9C48_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Big_11
Motif
Other DBs
NCBI-ProteinID: ARM26771
UniProt: A0A1W6HFG4
LinkDB All DBs
Position
488675..489844
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSKTVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFNRFKKLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
HLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLETINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaatgcttacggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcaatttcattgaggaaacggggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacggggtattctgttgaatggcttcaggaagctgcgcgccacctc
ggaagtaaaacagtgccgtttcatctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagtc
tgtaaaggcgtattcacccactttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttaaccgctttaaaaaattgatcgctccgctccctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
catttaaaaccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gtccccatcggctatgcggacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggaggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggatgaaatcgcagggcggcttgagacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaaacaagtag

DBGET integrated database retrieval system