KEGG   Bacillus vallismortis: B9C48_03275Help
Entry
B9C48_03275       CDS       T04948                                 

Definition
(GenBank) hypothetical protein
  KO
K06872  uncharacterized protein
Organism
bvm  Bacillus vallismortis
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    B9C48_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPM_phosphatase P16-Arc
Motif
Other DBs
NCBI-ProteinID: ARM26898
UniProt: A0A1W6HFQ8
LinkDB All DBs
Position
618613..619371
Genome map
AA seq 252 aa AA seqDB search
MKVSMKKACLFCFVLFLMLSFGLHTSASAAEQKHVYDNAHLLTKDETKKLEELAGKLGAK
RHTDFIILTANGTGGKDIEQYAGDFYDSHFSGSTAILTIDMKNREVFISGYKKAETYLNN
SRLNTIRNTISSDISAGHYEKAFQTYIKLAYKDMGKSPDDKSDNLLLTWWFQLIIAAAAA
GIAVTVMVYNSGGKVTVTGSTYMDHDTSEVLSQHDTYIRTDVTREKKPDKDNDNDGGVTR
GGTSYSGSKGSF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatcgatgaaaaaagcgtgtctcttctgcttcgtcctttttctgatgctgtct
tttggtttacatacatcggcgtctgccgcggaacagaagcatgtttatgacaatgctcat
ttattaacgaaggatgaaacgaagaaacttgaggaattggccgggaagctcggggcaaag
cgccataccgattttatcattctgaccgcaaatggaacgggcggtaaggatatcgagcag
tacgccggtgatttttatgacagtcattttagcggaagcacggcgattttgaccattgat
atgaaaaatcgggaagtatttatctccggatataaaaaggcggagacgtatttgaataac
agccggctgaatacgatcagaaatacgatctcgtcagatatttccgcaggccattatgaa
aaggcgtttcagacctacatcaagttggcttataaagatatggggaaaagcccggacgac
aagtctgacaatctgctgctcacatggtggtttcagctcattattgccgcagccgcggcc
ggaatcgccgtcactgtgatggtgtacaattccggcggcaaggtcaccgtcaccggcagc
acgtatatggatcacgatacgtctgaagtgctgagccagcacgacacatatatccgaacc
gacgttacaagagaaaaaaagcctgataaagataatgacaatgacggcggagtcacgagg
ggcggcacgagttacagcggaagcaagggtagtttttaa

DBGET integrated database retrieval system